DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and Try5

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001003405.1 Gene:Try5 / 103964 MGIID:102756 Length:246 Species:Mus musculus


Alignment Length:239 Identity:81/239 - (33%)
Similarity:119/239 - (49%) Gaps:31/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIHDQWVITAASCL-----AGLRKNNVQVVTTTY 103
            :||||......:.||.|||.:.|  |||.||:|:||||::||.|.     ..|.::|:.|:.   
Mouse    23 KIVGGYTCRENSIPYQVSLNSGY--HFCGGSLINDQWVVSAAHCYKTRIQVRLGEHNINVLE--- 82

  Fly   104 NHWGSEGWIYSVEDIVMHCNFDSPMYHNDIALIKTHALFDYDDVTQNITIA----PLEDLTDGET 164
               |:|.::.|.: |:.|.||:|...:|||.|||..:     .||.|..:|    |......|..
Mouse    83 ---GNEQFVNSAK-IIKHPNFNSRTLNNDIMLIKLAS-----PVTLNARVATVALPSSCAPAGTQ 138

  Fly   165 LTMYGYGST-EIGGDFSWQLQQLDVTYVAPEKCNATYGGTPDLDVGHLCAVG--KVGAGACHGDT 226
            ..:.|:|:| ..|.:....||.||...:....|.|:|   |.....::..||  :.|..:|.||:
Mouse   139 CLISGWGNTLSFGVNNPDLLQCLDAPLLPQADCEASY---PGKITNNMICVGFLEGGKDSCQGDS 200

  Fly   227 GGPIVDSRGRLVGVGNWGVPCGY-GFPDVFARISFYYSWIISTI 269
            |||:| ..|:|.|:.:||..|.. ..|.|:.::..|..||..||
Mouse   201 GGPVV-CNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWIQDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 77/233 (33%)
Tryp_SPc 45..268 CDD:238113 79/235 (34%)
Try5NP_001003405.1 Tryp_SPc 23..239 CDD:214473 77/233 (33%)
Tryp_SPc 24..242 CDD:238113 79/235 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.