DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and Prss51

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_038949850.1 Gene:Prss51 / 100910401 RGDID:6498506 Length:316 Species:Rattus norvegicus


Alignment Length:228 Identity:70/228 - (30%)
Similarity:107/228 - (46%) Gaps:28/228 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PYLVSLQNAYGNHFCAGSIIHDQWVITAASC----LAGLRKNNVQVV--TTTYNHWGSEGWIYSV 115
            |:.||:| ..|.|.|.|||||..||:|||.|    |..|...|:.||  ..|::....|..:  |
  Rat    49 PWQVSIQ-MLGKHLCGGSIIHQWWVLTAAHCFPRTLLELVAVNITVVLGIKTFSDINLERKL--V 110

  Fly   116 EDIVMHCNFDSPMYHNDIALIKTHALFDYDDVTQNITIAPLEDLTD----GETLTMYGYGSTEIG 176
            :.|:.|.::..|...:|:.|:......:::.|...|.:...|...|    .|....:|:||.:  
  Rat   111 QKIITHKDYKPPHLDSDLCLLLLATPIEFNKVKMPICLPQRESTWDRCWMAEWAYAHGHGSAK-- 173

  Fly   177 GDFSWQLQQLDVTYVAPEKCNATYGGTPDLDVGHLCAVGKVGA-GACHGDTGGPIV----DSRGR 236
             ..:..|::|.|..::...|...   ...|....|||..:.|. |.|.||:|.|:|    ::| |
  Rat   174 -GLNMHLKKLRVVQISWRTCAKR---VTQLSRNMLCAWKEAGTNGKCQGDSGAPMVCANWETR-R 233

  Fly   237 L--VGVGNWGVPCG-YGFPDVFARISFYYSWII 266
            |  |||.:|||..| .|.|.:|..::.:..||:
  Rat   234 LFQVGVFSWGVTSGSRGRPGMFVSVAQFIPWIL 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 68/225 (30%)
Tryp_SPc 45..268 CDD:238113 70/228 (31%)
Prss51XP_038949850.1 Tryp_SPc 42..265 CDD:214473 68/225 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335383
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.