DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and prss59.2

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001268923.1 Gene:prss59.2 / 100535672 ZFINID:ZDB-GENE-110408-10 Length:242 Species:Danio rerio


Alignment Length:267 Identity:77/267 - (28%)
Similarity:125/267 - (46%) Gaps:36/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 STLVLVLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHFCAG 73
            |.:.||||..:|        |...:|          ||||.|....:.|:..||.:.|  |||.|
Zfish     3 SLVFLVLLGAAF--------ALDDDK----------IVGGYECQPNSQPWQASLNSGY--HFCGG 47

  Fly    74 SIIHDQWVITAASCLAGLRKNNVQVVTTTYN---HWGSEGWIYSVEDIVMHCNFDSPMYHNDIAL 135
            |::.:.||::||.|.    |:.::|....:|   :.|:|.:|.| |.::.:.|:||....:||.|
Zfish    48 SLVSEYWVVSAAHCY----KSRLEVRLGEHNIVINEGTEQFITS-EKVIRNPNYDSWTIDSDIML 107

  Fly   136 IKTHALFDYDDVTQNITIAPLEDLTDGETLTMYGYGSTEIGGDFSWQLQQLDVTYVAPEKCNATY 200
            ||.......:...|.:.: |.....||....:.|:|:|......|.:||.|::..::...|..:|
Zfish   108 IKLSKPATLNKYVQPVAL-PNGCAADGTMCRVSGWGNTMSSTADSNKLQCLEIPILSDRDCKNSY 171

  Fly   201 GGTPDLDVGHLCAVGKV--GAGACHGDTGGPIVDSRGRLVGVGNWGVPCGY-GFPDVFARISFYY 262
               |.:....:...|.:  |..:|.||:|||:| ..|.|.|:.:||..|.. ..|.|:.::..:.
Zfish   172 ---PGMITDTMFCAGYLEGGKDSCQGDSGGPVV-CNGELQGIVSWGYGCAQKDNPGVYGKVCMFS 232

  Fly   263 SWIISTI 269
            .||..|:
Zfish   233 QWIADTM 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 66/226 (29%)
Tryp_SPc 45..268 CDD:238113 68/228 (30%)
prss59.2NP_001268923.1 Tryp_SPc 20..235 CDD:214473 67/236 (28%)
Tryp_SPc 21..238 CDD:238113 68/228 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.