DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and LOC100498083

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_012810073.2 Gene:LOC100498083 / 100498083 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:266 Identity:83/266 - (31%)
Similarity:129/266 - (48%) Gaps:37/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVLVLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHFCAGSI 75
            |:.|||..:        .||..:|          |:||......:.||:|||...|  |||.||:
 Frog     5 LICVLLGAA--------AAFDDDK----------IIGGATCAKNSVPYIVSLNAGY--HFCGGSL 49

  Fly    76 IHDQWVITAASCLAGLRKNNVQVVTTTYN---HWGSEGWIYSVEDIVMHCNFDSPMYHNDIALIK 137
            |::|||::||.|.    :.:|||....:|   ..|:|.:|.|.: ::.|..::|....|||.|||
 Frog    50 INNQWVVSAAHCY----QASVQVRLGEHNIAVSEGTEQFINSAK-VIRHSGYNSRTLDNDIMLIK 109

  Fly   138 THALFDYDDVTQNITIAPLEDLTDGETLTMYGYGSTEI-GGDFSWQLQQLDVTYVAPEKCNATYG 201
            ..:....:... |....|......|.:..:.|:|:|.. |.::...||.|:...:...:|:..|.
 Frog   110 LSSAASLNSAV-NAVALPSSCAAAGTSCLISGWGNTSASGSNYPNLLQCLNAPILTTAQCSGAYP 173

  Fly   202 GTPDLDVGHLCAVG--KVGAGACHGDTGGPIVDSRGRLVGVGNWGVPCGY-GFPDVFARISFYYS 263
            |  .:.....|| |  :.|..:|.||:|||:| ..|:|.|:.:||:.|.. .:|.|:.::..|.|
 Frog   174 G--QITNNMFCA-GFLEGGKDSCQGDSGGPVV-CNGQLQGIVSWGIGCAQRNYPGVYTKVCNYNS 234

  Fly   264 WIISTI 269
            ||.|||
 Frog   235 WIQSTI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 71/227 (31%)
Tryp_SPc 45..268 CDD:238113 73/229 (32%)
LOC100498083XP_012810073.2 Tryp_SPc 21..239 CDD:238113 73/229 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.