DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr8a and Gr68a

DIOPT Version :9

Sequence 1:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster


Alignment Length:427 Identity:84/427 - (19%)
Similarity:146/427 - (34%) Gaps:161/427 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LGRVLQFHLRLYQVLGFHGLPLPGDGNPARTRRRLMAWSLFLLISLSALVLACLFSG-------- 61
            ||..:.|..:.|:::.      ...|:.....|.:.  :|..:||.:.:||:.:.:.        
  Fly    55 LGEDVLFASKEYRLVA------SAQGDTEEINRTIE--TLLCIISYTMVVLSSVQNASRHFRTLH 111

  Fly    62 -----EEFLYRG---DMFGCANDALKYVFAELGVLAIYLETLSSQRHLANFWWLHFKLG-GQKTG 117
                 :|:|...   :.:.|.|..:....|..||||:            .|:::|::.| |.|..
  Fly   112 DIAKIDEYLLANGFRETYSCRNLTILVTSAAGGVLAV------------AFYYIHYRSGIGAKRQ 164

  Fly   118 LVSLRSEFQQFCRYLIFLYAMMAA--------EVAIHLGLWQFQALTQHMLLFWSTYEPLVWLTY 174
            ::.|...|.|      .||:.:.|        .:|..:|.     |.|.:..|            
  Fly   165 IILLLIYFLQ------LLYSTLLALYLRTLMMNLAQRIGF-----LNQKLDTF------------ 206

  Fly   175 LRNLQFVLHLELLREQLTGLEREMGLLAEYSRFASETGRSFPGFESFLRRRLVQKQRIYSHVYDM 239
              |||...|:|..||    |...:.:|.:: |:.:|.                            
  Fly   207 --NLQDCGHMENWRE----LSNLIEVLCKF-RYITEN---------------------------- 236

  Fly   240 LKCFQGAFNFSILAVLLTINIRIAVDCYFMYYSIYNNVINNDYYLIVPALLEIPAFIYASQ---- 300
            :.|..|.   |:|              ::..:|.|  .:.|..||   |...:.|...:|:    
  Fly   237 INCVAGV---SLL--------------FYFGFSFY--TVTNQSYL---AFATLTAGSLSSKTEVA 279

  Fly   301 -----SCMVVVPRIAHQLHNIVTDSGCCSCPDL-----------------SLQIQN----FSLQL 339
                 ||:.|   :|..:..||.   |.:|..|                 |.|.||    |..:.
  Fly   280 DTIGLSCIWV---LAETITMIVI---CSACDGLASEVNGTAQILARIYGKSKQFQNLIDKFLTKS 338

  Fly   340 LHQPIRIDCLGLTILDCSLLTRMACSVGTYMIYSIQF 376
            :.|.::....|...:|.|.|.::..:|.||::..|||
  Fly   339 IKQDLQFTAYGFFSIDNSTLFKIFSAVTTYLVILIQF 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 80/421 (19%)
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 84/427 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.