DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr8a and Gr66a

DIOPT Version :9

Sequence 1:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_523971.3 Gene:Gr66a / 38935 FlyBaseID:FBgn0035870 Length:527 Species:Drosophila melanogaster


Alignment Length:489 Identity:90/489 - (18%)
Similarity:172/489 - (35%) Gaps:141/489 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLQFHLRLYQVLGFHGLPLPGDGNPARTRRRL------MAWSLFLLISLSALVLACLFS-GEEFL 65
            :||...:|:.:....|: ||.|....|:|..|      |.:.|..||....|....::| |||  
  Fly    11 LLQQFQQLFFISKIAGI-LPQDLEKFRSRNLLEKSRNGMIYMLSTLILYVVLYNILIYSFGEE-- 72

  Fly    66 YRGDMFGCANDALKYV----FAELGVLAIYLETLSSQRHLANFWWLH----------FKLG---- 112
              ......:...|.:|    ...:|::.:..:.|::.|:......|:          :|.|    
  Fly    73 --DRSLKASQSTLTFVIGLFLTYIGLIMMVSDQLTALRNQGRIGELYERIRLVDERLYKEGCVMD 135

  Fly   113 ----GQK-------------TGLVSLRSEFQQFCRYLIFLYAMMAAEVAIHL--GLW---QFQAL 155
                |::             :.|||...:...:.:::..|:.:.|....|:.  .:|   ...||
  Fly   136 NSTIGRRIRIMLIMTVIFELSILVSTYVKLVDYSQWMSLLWIVSAIPTFINTLDKIWFAVSLYAL 200

  Fly   156 TQHMLLFWSTYEPLV--------WLTYLRNL----------QFVLHLELLREQLTGLEREMGLLA 202
            .:......:|.|.||        ||...:.:          |:..:||.|.::|.|:  ::|.:.
  Fly   201 KERFEAINATLEELVDTHEKHKLWLRGNQEVPPPLDSSQPPQYDSNLEYLYKELGGM--DIGSIG 263

  Fly   203 EYSRFASETGRSFP---GFESF---------------LRRRLVQKQ----------------RIY 233
            :.|...|...:..|   ...||               |...:|.:.                :::
  Fly   264 KSSVSGSGKNKVAPVAHSMNSFGEAIDAASRKPPPPPLATNMVHESELGNAAKVEEKLNNLCQVH 328

  Fly   234 SHVYDMLKCFQGAFNFSILAVLLTINIRIAVDCYFMYYSIYNNVINNDYYLIVPAL--------L 290
            ..:.::.|.....:::.||:::....:......||:|.:        ..|..:|:|        :
  Fly   329 DEICEIGKALNELWSYPILSLMAYGFLIFTAQLYFLYCA--------TQYQSIPSLFRSAKNPFI 385

  Fly   291 EIPAFIYASQSCMVVV----------PRIAHQLH--NIVTDSGCCSCPDLSLQIQN-FSLQLLHQ 342
            .:....|.|..|:.::          .|....||  .:|.|.      :|..:|.| .||:||:.
  Fly   386 TVIVLSYTSGKCVYLIYLSWKTSQASKRTGISLHKCGVVADD------NLLYEIVNHLSLKLLNH 444

  Fly   343 PIRIDCLGLTILDCSLLTRMACSVGTYMIYSIQF 376
            .:.....|...||...|..::..:.:|:|..|||
  Fly   445 SVDFSACGFFTLDMETLYGVSGGITSYLIILIQF 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 88/486 (18%)
Gr66aNP_523971.3 7tm_7 21..478 CDD:285581 85/477 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.