DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr8a and Gr63a

DIOPT Version :9

Sequence 1:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001137883.1 Gene:Gr63a / 38453 FlyBaseID:FBgn0035468 Length:489 Species:Drosophila melanogaster


Alignment Length:416 Identity:74/416 - (17%)
Similarity:141/416 - (33%) Gaps:114/416 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LQFHLRLYQVLGFHGLPLPGDGNPARTRRRLMAWSLFLLISLSALVLACLFSGEEFLYRGDMFGC 73
            :.:.||:..|     ||:...| |||.:..:.:.| |:...:..::|||        |.|.:   
  Fly    80 INWFLRIIGV-----LPIVRHG-PARAKFEMNSAS-FIYSVVFFVLLAC--------YVGYV--- 126

  Fly    74 ANDALKYV------FAELGVLAIYLETLSSQRHLANFWW-----------------LHFKLGGQK 115
            ||:.:..|      |.|..:..::|..:.....:...|:                 |::::.|. 
  Fly   127 ANNRIHIVRSLSGPFEEAVIAYLFLVNILPIMIIPILWYEARKIAKLFNDWDDFEVLYYQISGH- 190

  Fly   116 TGLVSLRSEFQQFCRYLIFLYAMMA--AEVAIHLGLWQFQA-----------LTQHMLLFWSTYE 167
                ||..:.:|...|:..:..:::  :.|..|:.:.....           ||. ||..|    
  Fly   191 ----SLPLKLRQKAVYIAIVLPILSVLSVVITHVTMSDLNINQVVPYCILDNLTA-MLGAW---- 246

  Fly   168 PLVWLTYLRNLQFVLHLELLREQLTGLEREMG---LLAEY-------SRFASETGRSFPGFESFL 222
               |......:....|  ||.|:.....:.:|   ::|:|       |:...:||.:.       
  Fly   247 ---WFLICEAMSITAH--LLAERFQKALKHIGPAAMVADYRVLWLRLSKLTRDTGNAL------- 299

  Fly   223 RRRLVQKQRIYSHVYDMLKCFQGAFNFSILAVLLTINIRIAVDCYFMYYSIYNNVINNDYYLIVP 287
                               |:...|....|..::|::|      |.:...:.......|..|.:.
  Fly   300 -------------------CYTFVFMSLYLFFIITLSI------YGLMSQLSEGFGIKDIGLTIT 339

  Fly   288 ALLEIPAFIYASQSC--MVVVPRIAHQLHNIVTDSGCCSCPDLSLQIQNFSLQLLHQPIRIDCLG 350
            ||..|....|.....  ..|..|...|...::.:....: .|...:|..|.......|..|:|.|
  Fly   340 ALWNIGLLFYICDEAHYASVNVRTNFQKKLLMVELNWMN-SDAQTEINMFLRATEMNPSTINCGG 403

  Fly   351 LTILDCSLLTRMACSVGTYMIYSIQF 376
            ...::.:|...:..::.||::..:||
  Fly   404 FFDVNRTLFKGLLTTMVTYLVVLLQF 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 72/414 (17%)
Gr63aNP_001137883.1 7tm_7 79..433 CDD:285581 74/416 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.