DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr8a and Gr59f

DIOPT Version :9

Sequence 1:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster


Alignment Length:280 Identity:58/280 - (20%)
Similarity:113/280 - (40%) Gaps:71/280 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 QQFCRYLIFLYAMMAAEVAIHLGLWQFQALTQHMLLFWSTYEPLVWLTYLRNLQFVLHLELL--- 187
            ::|.|..:||..:.|. :||...:|..:.:....:|..::|   |....:.::.|..:..||   
  Fly   150 KRFIRLQLFLVGIFAC-LAIFFNIWTHKFVVYRSILSINSY---VMPNIISSISFAQYYLLLQGI 210

  Fly   188 ---REQLT-GLEREMGLLAEYSRFASETGRSFPGFESFLRRRLVQKQRI-YSHVYDMLKCFQGAF 247
               :.:|| |||||:..|  :|...||                |||.|: ::::.|..|.....|
  Fly   211 AWRQRRLTEGLERELTHL--HSPRISE----------------VQKIRMHHANLIDFTKAVNRTF 257

  Fly   248 NFSILAVLLTINIRIAVDCYFMY----YSIYNNVINNDYYLIVPALLEIPAFIYASQSCMVV--- 305
            .:|||.:.        |.|:..:    :.:|..:.|       |::.:...::     ||::   
  Fly   258 QYSILLLF--------VGCFLNFNLVLFLVYQGIEN-------PSMADFTKWV-----CMLLWLA 302

  Fly   306 --VPRIAHQLH---NIVTDSGCC---------SCPDLSLQIQNFSLQLLHQPIRIDCLGLTILDC 356
              |.::...||   :|..:...|         :..|:...|.:|.:|:.....:....|:..||.
  Fly   303 MHVGKVCSILHFNQSIQNEHSTCLTLLSRVSYARKDIQDTITHFIIQMRTNVRQHVVCGVINLDL 367

  Fly   357 SLLTRMACSVGTYMIYSIQF 376
            ..||.:..:...:.|:.:|:
  Fly   368 KFLTTLLVASADFFIFLLQY 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 57/278 (21%)
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 58/280 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.