DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr8a and Gr58b

DIOPT Version :9

Sequence 1:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_523808.2 Gene:Gr58b / 37502 FlyBaseID:FBgn0041238 Length:408 Species:Drosophila melanogaster


Alignment Length:381 Identity:71/381 - (18%)
Similarity:140/381 - (36%) Gaps:118/381 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LMAWSLFLLISLSAL-VLACLFSGEEFLYRGDMFGCANDALKYVFAELGVLAIYLETLSSQRHLA 102
            ::.|:.|:::.|.|: |::|.  |..:|.|..                 ::.:|..:|       
  Fly    78 VLQWNFFVMLFLRAIAVVSCY--GTLWLKRHK-----------------IIQLYKYSL------- 116

  Fly   103 NFWWLHF----KLGGQKTGLVSLRSEFQQ-FCRYLIFLYAMMAAEVAIHLGLWQFQALTQHMLLF 162
             .:|..|    :....|..|:.|:....: ..|.:|.||:.......:     |:|.|       
  Fly   117 -IYWKRFGHITRAIVDKKELLDLQESLARIMIRKIILLYSAFLCSTVL-----QYQLL------- 168

  Fly   163 WSTYEPLVWLTYLRNLQFVLH-----------LELLREQLTGLEREMGLLAEYSRFASETGRSFP 216
             |...|.::|.:...|...||           |.||..|.  |...:.:.|.:.|.|.:..::..
  Fly   169 -SVINPQIFLAFCARLTHFLHFLCVKMGFFGVLVLLNHQF--LVIHLAINALHGRKARKKWKALR 230

  Fly   217 GFESFLRRRLVQKQRIYSHVYDMLKCFQGAFNFSILAVLLTINI-RIAVDCYFMYYSI-YNN--V 277
            ...:...:.|    |:...::||         |.|....:.||: ..|::  .:|::: |:|  :
  Fly   231 SVAAMHLKTL----RLARRIFDM---------FDIANATVFINMFMTAIN--ILYHAVQYSNSSI 280

  Fly   278 INNDYYLIVPALLEIPAFIYASQSCMVVVPRIAHQLHNIVTDSGCCSC----------------- 325
            .:|.:.::....|.:..| :.:.:.|       ..|.::||     ||                 
  Fly   281 KSNGWGILFGNGLIVFNF-WGTMALM-------EMLDSVVT-----SCNNTGQQLRQLSDLPKVG 332

  Fly   326 PDLSLQIQNFSLQLLHQPIRIDCLGLTILDCSLLTRMAC-----SVGTYMIYSIQF 376
            |.:..::..|::||....:.....|:..||     :.||     |:.:.:|..:||
  Fly   333 PKMQRELDVFTMQLRQNRLVYKICGIVELD-----KPACLSYIGSILSNVIILMQF 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 69/379 (18%)
Gr58bNP_523808.2 7tm_7 12..385 CDD:285581 71/381 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.