DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr8a and Gr57a

DIOPT Version :9

Sequence 1:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster


Alignment Length:377 Identity:72/377 - (19%)
Similarity:134/377 - (35%) Gaps:138/377 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLQFHLRLYQVLGFHGLPLPGDGNPARTRRRLMAWSLFLLISLSALVLACLFSG----------E 62
            :|||      ::|.:|..:      .|:..|:...|....:|::.....|||..          .
  Fly    22 ILQF------LMGCNGFGI------RRSTFRISWASRIYSMSVAIAAFCCLFGSLSVLLAEEDIR 74

  Fly    63 EFLYRGDMFGCANDALKYVFAEL--GVLAIYLETLSSQRHLANFWWLHFKLGGQKTGLVSLR--S 123
            |.|.:.|....:..||:.:.:.|  ||..|.|:.. ::|||..:         |:...:..|  |
  Fly    75 ERLAKADNLVLSISALELLMSTLVFGVTVISLQVF-ARRHLGIY---------QRLAALDARLMS 129

  Fly   124 EFQQFCRY---------------LIFLYAMMAAEVAI---HLGLWQFQALTQ------------- 157
            :|.....|               .|:|.|:.:|.|.:   |..|:...||..             
  Fly   130 DFGANLNYRKMLRKNIAVLGIVTTIYLMAINSAAVQVASGHRALFLLFALCYTIVTGGPHFTGYV 194

  Fly   158 HMLLF------WSTYEPLVWLTYLRNLQF-VLHLELLR-EQLTGLEREMGLLAEYSRFASETGRS 214
            ||.|.      :...:.|:...:| |.:| .||::.|| .|:..:.:|:..|.:           
  Fly   195 HMTLAEMLGIRFRLLQQLLQPEFL-NWRFPQLHVQELRIRQVVSMIQELHYLIQ----------- 247

  Fly   215 FPGFESFLRRRLVQKQRIY------SHVYDMLKCFQGAFNFSILAVLLTINIRIAV-------DC 266
                         :..|:|      :..:|:      |.:.|.|.:|...::.|..       .|
  Fly   248 -------------EINRVYALSLWAAMAHDL------AMSTSELYILFGQSVGIGQQNEEENGSC 293

  Fly   267 YFM--YYSIYNNVINNDYYLIVPALLEI---PAF----IYASQSCMVVVPRI 309
            |.|  |.::          :::|.|.::   |.:    ||.::.|:.:|.::
  Fly   294 YRMLGYLAL----------VMIPPLYKLLIAPFYCDRTIYEARRCLRLVEKL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 72/376 (19%)
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 67/361 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.