DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr8a and Gr43a

DIOPT Version :9

Sequence 1:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001286158.1 Gene:Gr43a / 35655 FlyBaseID:FBgn0041243 Length:453 Species:Drosophila melanogaster


Alignment Length:449 Identity:86/449 - (19%)
Similarity:144/449 - (32%) Gaps:150/449 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 AWSLFLLISLSALVLACLFSGEEFLYRGDMFGCAND-----------ALKYVFAELGVLAIYLET 94
            :| ||.:.|.:..|:....:     |||.:|...::           |...|...|.|..:.:..
  Fly    37 SW-LFTVYSATLTVVMVFLT-----YRGLLFDANSEIPVRASFRMKSATSKVVTALDVSVVVMAI 95

  Fly    95 LSSQRHLANFWWLHFKLGGQKTGLVSLR----------------SEFQQFCRYLIFLYAMMAAE- 142
            :|                |...||.||.                :.:..|.|.......|.|.. 
  Fly    96 VS----------------GVYCGLFSLNDTLELNDRLNKIDNTLNAYNNFRRDRWRALGMAAVSL 144

  Fly   143 ------VAIHLGLWQFQALTQHMLLFWSTYEPLV-WLTYLRNLQFVL-HLEL-LREQLTGLEREM 198
                  |.:.:|.|  ..:.|.|.:..|..|..| |.....:|.|:| .|:: :.....||.|..
  Fly   145 LAISILVGLDVGTW--MRIAQDMNIAQSDTELNVHWYIPFYSLYFILTGLQVNIANTAYGLGRRF 207

  Fly   199 GLLAEY--SRFASE------------------------------------TGRSFP--------- 216
            |.|...  |.|.:|                                    .|.:.|         
  Fly   208 GRLNRMLSSSFLAENNATSAIKPQKVSTVKNVSVNRPAMPSALHASLTKLNGETLPSEAAGDKAA 272

  Fly   217 -------------GFESFLRRRLVQKQRIYSHVYDMLKC---FQGAFNFSILAVLLTINIRIAVD 265
                         |:.....:.|:.|....|| ..:.||   ...:|..::|.:|::..:.:...
  Fly   273 ARSLILNVELLKLGYFPAKNKGLLLKSLADSH-ESLGKCVHLLSNSFGIAVLFILVSCLLHLVAT 336

  Fly   266 CYFMYYSIYNNVINNDYYLIVPAL------LEI-----PAFIYA--SQSCMVVVPRIAHQLHNIV 317
            .||::..:.:...|.  ||.|..|      |.:     |..:.|  |:..:.:|..|..::|.  
  Fly   337 AYFLFLELLSKRDNG--YLWVQMLWICFHFLRLLMVVEPCHLAARESRKTIQIVCEIERKVHE-- 397

  Fly   318 TDSGCCSCPDLSLQIQNFSLQLLHQPIRIDCLGLTILDCSLLTRMACSVGTYMIYSIQF 376
                    |.|:..::.|..|||.........||..::.::||..|.::.||::..|||
  Fly   398 --------PILAEAVKKFWQQLLVVDADFSACGLCRVNRTILTSFASAIATYLVILIQF 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 84/447 (19%)
Gr43aNP_001286158.1 7tm_7 10..449 CDD:285581 86/449 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.