DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr8a and Gr33a

DIOPT Version :9

Sequence 1:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_525102.4 Gene:Gr33a / 34641 FlyBaseID:FBgn0032416 Length:475 Species:Drosophila melanogaster


Alignment Length:460 Identity:89/460 - (19%)
Similarity:148/460 - (32%) Gaps:169/460 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 FLLISLSALVLACLFSGEEFLYRGDMFGCANDALKYVFAELGVLAIYLETLSSQ--RHLANFWWL 107
            :|||:||.::..||...            .|...|               |||.  .||..|.:|
  Fly    44 YLLINLSHIIGLCLLDS------------CNSVCK---------------LSSHLFMHLGAFLYL 81

  Fly   108 HFKLGGQKTGLVSLRSEFQQFCRYLIFLYAMM-----AAE------------VAIHLGLWQFQ-- 153
            ...|    ..|...:..||||...|..:.|::     .||            ||.|. .|.|.  
  Fly    82 TITL----LSLYRRKEFFQQFDARLNDIDAVIQKCQRVAEMDKVKVTAVKHSVAYHF-TWLFLFC 141

  Fly   154 ----ALTQHMLLFWSTYEPLVWLTYLRNL-----------QFVLHLELLR---EQLTGLEREMGL 200
                ||...:...:.|:..|.::.::.:.           :|:.|:.::.   ||:..|..::..
  Fly   142 VFTFALYYDVRSLYLTFGNLAFIPFMVSSFPYLAGSIIQGEFIYHVSVISQRFEQINMLLEKINQ 206

  Fly   201 LAEYSRFASET----------------------GRSFPGF---ESF---LRRRLVQKQRIYSHV- 236
            .|.: |.|..|                      ||:..||   ..|   ::|:..|::.....: 
  Fly   207 EARH-RHAPLTVFDIESEGKKERKTVTPITVMDGRTTTGFGNENKFAGEMKRQEGQQKNDDDDLD 270

  Fly   237 -----------YDMLKCFQGAFNFS-------------ILAVLLTINIRIAVDC--YF---MYYS 272
                       ||.....:...|.|             |||:.:..|......|  |.   ...|
  Fly   271 TSNDEDEDDFDYDNATIAENTGNTSEANLPDLFKLHDKILALSVITNGEFGPQCVPYMAACFVVS 335

  Fly   273 IYNNVINNDYYLIV---PALLEIPAFIYASQS-CMVVVPRIAHQLHNIVTDSGCCSCPDLSLQ-- 331
            |:...:......||   ..||:...::|...| ..::|..|..:|        ||:..:.|.|  
  Fly   336 IFGIFLETKVNFIVGGKSRLLDYMTYLYVIWSFTTMMVAYIVLRL--------CCNANNHSKQSA 392

  Fly   332 -----------------------IQNFSLQLLHQP--IRIDCLGLTILDCSLLTRMACSVGTYMI 371
                                   :::|:||.||..  .:.:.:||..||.:.:.....:..:|:|
  Fly   393 MIVHEIMQKKPAFMLSNDLFYNKMKSFTLQFLHWEGFFQFNGVGLFALDYTFIFSTVSAATSYLI 457

  Fly   372 YSIQF 376
            ..:||
  Fly   458 VLLQF 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 87/458 (19%)
Gr33aNP_525102.4 7tm_7 <289..465 CDD:303125 36/182 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.