DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr8a and Gr2a

DIOPT Version :9

Sequence 1:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001162633.1 Gene:Gr2a / 31093 FlyBaseID:FBgn0265139 Length:428 Species:Drosophila melanogaster


Alignment Length:414 Identity:90/414 - (21%)
Similarity:156/414 - (37%) Gaps:88/414 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PLPGDGNPARTRRRLMAWSLFLLISLSALVLACLFSGEEFLYRGD------MFGCANDALKYVFA 83
            |...:|...|..|.|..:...:||:.::..:..||.......:.|      ..|...|.::.|..
  Fly    27 PPDSEGILLRRSRWLELYGWTVLIAATSFTVYGLFQESSVEEKQDSESTISSIGHTVDFIQLVGM 91

  Fly    84 ELGVLAIYLETLSSQRHLANFWWLHFKLGGQKTGLVS--LRSEFQ--------QFCRYLIFLYAM 138
            .:..||..||.|..::....|    |...|:...|:|  ||.:.:        |..|..:::   
  Fly    92 RVAHLAALLEALWQRQAQRGF----FAELGEIDRLLSKALRVDVEAMRINMRRQTSRRAVWI--- 149

  Fly   139 MAAEVAIHLGLWQFQALTQHMLLFWSTYE-----PLVWLTY--------LRNLQFVLHLELLREQ 190
                      ||.: |::|.::|......     |:.|::|        ||..|.....:|:|::
  Fly   150 ----------LWGY-AVSQLLILGAKLLSRGDRFPIYWISYLLPLLVCGLRYFQIFNATQLVRQR 203

  Fly   191 LTGLEREMGLLAEYSRFASETGRSFPGFESFLRR----------RLVQKQRIYSHVYDMLKCFQG 245
            |..|     |:|.......:.|   |..::.|..          ||:..:.:|..|:.::.....
  Fly   204 LDVL-----LVALQQLQLHQKG---PAVDTVLEEQEDLEEAAMDRLIAVRLVYQRVWALVALLNR 260

  Fly   246 AFNFSILAVLLTINIRIAVDCYFMYYSIYNNVINN-DYYLIVPA----------LLEIPAFIYAS 299
            .:..|:|..:....:.|..:||:|:.:...:..:. |...||.:          :|.:......:
  Fly   261 CYGLSMLMQVGNDFLAITSNCYWMFLNFRQSAASPFDILQIVASGVWSAPHLGNVLVLSLLCDRT 325

  Fly   300 QSCMVVVPRIAHQL--------HNIVTDSGCCSCPDL----SLQIQNFSLQLLHQPIRIDCLGLT 352
            ..|...:....||:        ||.:..:....|..|    .|||..||||||||.:.....|..
  Fly   326 AQCASRLALCLHQVSVDLRNESHNALVGTLVRYCAPLIILVPLQITQFSLQLLHQRLHFSAAGFF 390

  Fly   353 ILDCSLLTRMACSVGTYMIYSIQF 376
            .:||:||..:..:..||:|..|||
  Fly   391 NVDCTLLYTIVGATTTYLIILIQF 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 88/412 (21%)
Gr2aNP_001162633.1 7tm_7 7..418 CDD:285581 90/414 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.