DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr8a and Gr10a

DIOPT Version :9

Sequence 1:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_727523.1 Gene:Gr10a / 117501 FlyBaseID:FBgn0045502 Length:408 Species:Drosophila melanogaster


Alignment Length:349 Identity:71/349 - (20%)
Similarity:132/349 - (37%) Gaps:89/349 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 NDALKYVFAELGVLAIYLETLSSQRHLANFWWLHFKLGGQKTGLVSLRSEFQ------------- 126
            |.|:||.    .|:..|         :||  .:||:...|:..:.....||:             
  Fly    94 NTAIKYA----TVIVTY---------VAN--TVHFEAINQRCTMQRTHLEFEFKNAPQEPKRPFE 143

  Fly   127 -----QFCRYLIFLYAMM----------------AAEVAIHLGLWQFQALTQHMLLFWSTYEPLV 170
                 :||  ||.|..|:                .::|.:|..::.|        :.|:..|.:.
  Fly   144 FFMYFKFC--LINLMMMIQVCGIFAQYGEVGKGSVSQVRVHFAIYAF--------VLWNYTENMA 198

  Fly   171 WLTYLRN-------LQFVLHLELLREQLTGLEREMGLLAEYSRFASETGRSFPGFESFLRRRLVQ 228
            ...|..|       .||.|.|..||:::.|| |..|:|..:....|:              ||.:
  Fly   199 DYCYFINGSVLKYYRQFNLQLGSLRDEMDGL-RPGGMLLHHCCELSD--------------RLEE 248

  Fly   229 KQRIYSHVYDMLKCFQGAFNFSILAVLLTINIRIAVDCYFMYYSIYNNVINNDYYLIVPALLEIP 293
            .:|....::|:.:.......|.::.::|:..|....:.|.:::.:....:....|.:|...:...
  Fly   249 LRRRCREIHDLQRESFRMHQFQLIGLMLSTLINNLTNFYTLFHMLAKQSLEEVSYPVVVGSVYAT 313

  Fly   294 AFIYASQSCMVVVPRIAHQLHNIVTDSGCCSCP-----DLSLQIQNFSLQLL-HQPIRIDCLGLT 352
            .|...:....::...|..:|..:.......:.|     .|:.:|::.||:|| :||..: | ||.
  Fly   314 GFYIDTYIVALINEHIKLELEAVALTMRRFAEPREMDERLTREIEHLSLELLNYQPPML-C-GLL 376

  Fly   353 ILDCSLLTRMACSVGTYMIYSIQF 376
            .||..|:..:|.:..:|.|..:||
  Fly   377 HLDRRLVYLIAVTAFSYFITLVQF 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 69/347 (20%)
Gr10aNP_727523.1 7tm_7 20..402 CDD:285581 71/349 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.