DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr8a and Gr22e

DIOPT Version :9

Sequence 1:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_722731.1 Gene:Gr22e / 117498 FlyBaseID:FBgn0045497 Length:389 Species:Drosophila melanogaster


Alignment Length:313 Identity:66/313 - (21%)
Similarity:114/313 - (36%) Gaps:102/313 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 GLWQFQALT--QHMLL--FWSTYEPLVWLTYLRNLQ-----------------FVLH--LELLRE 189
            |:...|:|:  ..|||  ||.:.:....|..|.:||                 |||:  ..::.|
  Fly    90 GIHDIQSLSMVSIMLLRSFWKSGDIERTLNELEDLQHRYFRNYSLEECISFDRFVLYKGFSVVLE 154

  Fly   190 QLTGLEREMGLLAEYSRFASETGRSFPGFES--------------------FLRR---------- 224
            .::.|..|:|:...||      .:.|.|..|                    |:.|          
  Fly   155 LVSMLVLELGMSPNYS------AQFFIGLGSLCLMLLAVLLGASHFHLAVVFVYRYVWIVNRELL 213

  Fly   225 RLVQKQRI---------------YSHVYDMLKCFQGAFNFSILAVLLTINIRIAVDCY-FMYYSI 273
            :||.|..|               |..:.|:.:.....:::.::.|:::..|...:..| |:.|||
  Fly   214 KLVNKMAIGETVESERMDLLLYLYHRLLDLGQRLASIYDYQMVMVMVSFLIANVLGIYFFIIYSI 278

  Fly   274 YNN--------------VINN-DYYLIVPALLEIPAFIYASQSCMVVVPRIAHQLHNIVTDSGCC 323
            ..|              |||. |::|.|    ||......:......:.::.:.:.||  |.   
  Fly   279 SLNKSLDFKILVFVQALVINMLDFWLNV----EICELAERTGRQTSTILKLFNDIENI--DE--- 334

  Fly   324 SCPDLSLQIQNFSLQLLHQPIRIDCLGLTILDCSLLTRMACSVGTYMIYSIQF 376
               .|...|.:|:|...|:.:|....||..::..:..|||.:...|:::.|||
  Fly   335 ---KLERSITDFALFCSHRRLRFHHCGLFYVNYEMGFRMAITSFLYLLFLIQF 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 64/311 (21%)
Gr22eNP_722731.1 7tm_7 18..388 CDD:285581 66/313 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.