DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr8a and Gr28b

DIOPT Version :9

Sequence 1:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_995642.1 Gene:Gr28b / 117496 FlyBaseID:FBgn0045495 Length:470 Species:Drosophila melanogaster


Alignment Length:402 Identity:77/402 - (19%)
Similarity:149/402 - (37%) Gaps:101/402 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LMAWSLFLLISLSALVLACLFSGEEFLYRGDMFGCANDALKYVFAELGVLAIYLETL----SSQR 99
            :.|:||.:..:..:  :|..|......|.||:       ::.|...:||..|||...    ..:|
  Fly    91 VFAYSLTIYNNCES--VASYFFRSRITYFGDL-------MQIVSGFIGVTVIYLTAFVPNHRLER 146

  Fly   100 HLANFWWLHFKLGGQKTGLVSLRSEFQQFCRYLIFL--------------YAMMAAEVAIHLGLW 150
            .|..|..:..:|  |..|:..:.|:..:| .|::.:              ..:.::|||..:.| 
  Fly   147 CLQKFHTMDVQL--QTVGVKIMYSKVLRF-SYMVLISMFLVNVLFTGGTFSVLYSSEVAPTMAL- 207

  Fly   151 QFQALTQHMLL-----FWSTYEPLVWLTYLRNLQFVLHLELLREQLTGLEREMGLLAEYS----R 206
            .|..|.||.::     .:|.:      |||..::.|:..::|:          .|..::.    :
  Fly   208 HFTFLIQHTVIAIAIALFSCF------TYLVEMRLVMVNKVLK----------NLAHQWDTRSLK 256

  Fly   207 FASETGRSFPGFESFLRRRLVQK---------QRIYSHVYDMLKCFQGAFNFSILAVLLTINIRI 262
            ..::..||....:||....:|.|         ..|:..:.:........|.:.:|.::....:.|
  Fly   257 AVNQKQRSLQCLDSFSMYTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLII 321

  Fly   263 AVDCYFMYYSIYNNVINNDYYLIVPALLEIPAFIYASQSCMVVVPRIA----------------- 310
            ..|.|::..::.........:..|    |...|.    ||.:::..||                 
  Fly   322 VFDAYYVLETLLGKSKRESKFKTV----EFVTFF----SCQMILYLIAIISIVEGSNRAIKKSEK 378

  Fly   311 -----HQLHNIVTDSGCCSCPDLSLQIQNFSLQLLHQPIRIDCLGLTILDCSLLTRMACSVGTYM 370
                 |.|.|....:      ::..::|.||:||:|..|.....||..:|.:|...::.::.||:
  Fly   379 TGGIVHSLLNKTKSA------EVKEKLQQFSMQLMHLKINFTAAGLFNIDRTLYFTISGALTTYL 437

  Fly   371 IYSIQFIPKFSN 382
            |..:||.....|
  Fly   438 IILLQFTSNSPN 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 74/394 (19%)
Gr28bNP_995642.1 7tm_7 45..443 CDD:285581 74/394 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.