DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr8a and Gr22b

DIOPT Version :9

Sequence 1:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001014456.1 Gene:Gr22b / 117492 FlyBaseID:FBgn0045500 Length:386 Species:Drosophila melanogaster


Alignment Length:410 Identity:83/410 - (20%)
Similarity:149/410 - (36%) Gaps:107/410 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVLQFHLRLYQVLGFHGLPLPGDGNPARTRRRLMAWSLFLLISLSALVLACLFSGEEFLYRGDMF 71
            |:.|  ||..:.|..:||.|                :.||:.:|..|.         |.||....
  Fly    39 RIRQ--LRRSRCLTLYGLVL----------------NYFLIFTLIRLA---------FEYRKHKL 76

  Fly    72 GC--ANDALKYVFAELGVLAIYLETLSSQRHLANFWWLHFKLGGQKTGLVS---LRSEFQQF--- 128
            ..  .|..|:.:...:|::.:....:.   |..|||      |.:|.|.:.   |..|:|.|   
  Fly    77 EAFKRNPVLEMINVVIGIINVLSALIV---HFMNFW------GSRKVGEICNELLILEYQDFEGL 132

  Fly   129 ---------------C-----RYLIFL---YAMMAAEVAIHLGLWQFQALTQHML-LFWSTYEPL 169
                           |     :.|.|.   :|:...|  .|:.|.....|.:..| |....|...
  Fly   133 NGRNCPNFNCFVIQKCLTILGQLLSFFTLNFALPGLE--FHICLVLLSCLMEFSLNLNIMHYHVG 195

  Fly   170 VWLTYLRNLQFVLHLELLREQLTGLEREMGLLAE--YSRFASETGRSFPGFESFLRRRL-VQKQR 231
            |.|.|       .::.|:.|||..|..::.|..|  :||...        |.|..:|.| :.::.
  Fly   196 VLLIY-------RYVWLINEQLKDLVSQLKLNPETDFSRIHQ--------FLSLYKRLLELNRKL 245

  Fly   232 IYSHVYDMLKCFQGAFNFSILAVLLTINIRIAVDCYFMYYSIY-NNVINN--DYYLIVPA--LLE 291
            :.::.|.|........:.:|:.:...|...:::..|.::...: |:::.|  |::|.:.|  |.|
  Fly   246 VIAYEYQMTLFIIAQLSGNIVVIYFLIVYGLSMRTYSIFLVAFPNSLLINIWDFWLCIAACDLTE 310

  Fly   292 IPAFIYASQSCMVVVPRIAHQLHNIVTDSGCCSCPDLSLQIQNFSLQLLHQPIRIDCLGLTILDC 356
                 .|.....:::...:...|.   |.      .|.:.:..|:....|:..|....||..::|
  Fly   311 -----KAGDETAIILKIFSDLEHR---DD------KLEMSVNEFAWLCSHRKFRFQLCGLFSMNC 361

  Fly   357 SLLTRMACSVGTYMIYSIQF 376
            .:..:|..:...|::|.:||
  Fly   362 RMGFKMIITTFLYLVYLVQF 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 80/406 (20%)
Gr22bNP_001014456.1 7tm_7 17..385 CDD:285581 83/410 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.