DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr8a and Gr36a

DIOPT Version :9

Sequence 1:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_724038.2 Gene:Gr36a / 117488 FlyBaseID:FBgn0045487 Length:391 Species:Drosophila melanogaster


Alignment Length:444 Identity:82/444 - (18%)
Similarity:166/444 - (37%) Gaps:133/444 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GHLGRVLQFHLRLYQVLGFHGLPLPGDGNPARTRRRLMAWSLFLLISLSALVLACL--------- 58
            |.|.:||.::   .|::|.....:...      |.|::|....:|.:::..||.|:         
  Fly     6 GLLLKVLYYY---GQIIGLINFEIDWQ------RGRVVAAQRGILFAIAINVLICMVLLLQISKK 61

  Fly    59 FSGEEFLYRGDMFGCANDALKYVFAELGVLAIYLETLSSQRHLANFWWLHFKLGGQKTGLVSL-- 121
            |:.:.:      ||.||...:||.    ::.:.|...|....:.|.|       .|:..|:.|  
  Fly    62 FNLDVY------FGRANQLHQYVI----IVMVSLRMASGISAILNRW-------RQRAQLMRLVE 109

  Fly   122 --------RSEFQQFCRYLI-----------FLYAMMAAEVAIHLGLWQF--------------Q 153
                    :...:|..|:.|           ||...::.|....||..:|              .
  Fly   110 CVLRLFLKKPHVKQMSRWAILVKFSVGVVSNFLQMAISMESLDRLGFNEFVGMASDFWMSAIINM 174

  Fly   154 ALTQHMLLFWSTYEPLVWLTYLRNLQFVLHLELLREQLTGLEREMGLLAE-YSR---------FA 208
            |::||.|:          :.::|     .:..||:.::.....|..:|:| |.|         :.
  Fly   175 AISQHYLV----------ILFVR-----AYYHLLKTEVRQAIHESQMLSEIYPRRAAFMTKCCYL 224

  Fly   209 SETGRSFPGFESFLRRRLVQKQRIYSHVYDMLKCFQGAFNFSILAVLLT------------INIR 261
            ::...:....::.|:..:.|..:::.  ...:..:.|.:.||:....:|            :::|
  Fly   225 ADRIDNIAKLQNQLQSIVTQLNQVFG--IQGIMVYGGYYIFSVATTYITYSLAINGIEELHLSVR 287

  Fly   262 IA--VDCYFMYYSIYNNVINNDYYLIVPALLEIPAFIYASQSCMVVVPRIAHQLHNIVTDSGCCS 324
            .|  |..:|::|  |.:.|.|.:.::.         ::.....|   .||..: ..:.|     |
  Fly   288 AAALVFSWFLFY--YTSAILNLFVMLK---------LFDDHKEM---ERILEE-RTLFT-----S 332

  Fly   325 CPDLSLQ--IQNFSLQLLHQPIRIDCLGLTILDCSLLTRMACSVGTYMIYSIQF 376
            ..|:.|:  .::..|||:..|::|:.|.:..:..|....|..|:.|..|:.||:
  Fly   333 ALDVRLEQSFESIQLQLIRNPLKIEVLDIFTITRSSSAAMIGSIITNSIFLIQY 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 78/436 (18%)
Gr36aNP_724038.2 7tm_7 9..390 CDD:285581 80/441 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.