DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr8a and Gr59a

DIOPT Version :9

Sequence 1:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_726287.2 Gene:Gr59a / 117485 FlyBaseID:FBgn0045483 Length:367 Species:Drosophila melanogaster


Alignment Length:340 Identity:63/340 - (18%)
Similarity:110/340 - (32%) Gaps:136/340 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 TGLVSLRSEFQQ------FCRYL--IFLYAMMAAEVAIHLGLWQFQALTQHMLLFWSTYEPLV-- 170
            |...::..:|:|      :|..:  |||..:.:|                    ||.:.:.|.  
  Fly    18 TSYETMGGKFRQSRITRIYCLLINAIFLTLLPSA--------------------FWKSAKLLSTA 62

  Fly   171 -WL-TYLR---------NLQFVLHLELLR----EQLTGLEREMGLLAEYSRFASETGRSFPGFES 220
             |: :|:|         |...:.:..:.|    ..|..|:|   ::.|.:|....||:.   ..|
  Fly    63 DWMPSYMRVTPYIMCTINYAAIAYTLISRCYRDAMLMDLQR---IVLEVNREMLRTGKK---MNS 121

  Fly   221 FLRRRLVQKQRIYSHVYDMLKCFQGAF-------NFSILAVLLTINIRIA---VDCYFMYYSIYN 275
            .|||....|  .::..|..|......|       |:|.|...|.:||.:.   |:.:|.:.|:::
  Fly   122 LLRRMFFLK--TFTLTYSCLSYILAVFIYQWKAQNWSNLCNGLLVNISLTILFVNTFFYFTSLWH 184

  Fly   276 NVINNDYYLIVPALLEIPAFIYASQSCMVVVPRIAHQLHNIVTDSGCCSCPDLSLQIQNF-SLQL 339
            .....|:                          :..||:.||    .|...||..:.:.. .|..
  Fly   185 IARGYDF--------------------------VNQQLNEIV----ACQSMDLERKSKELRGLWA 219

  Fly   340 LHQ------------------PIRIDCLGLTILDCSLLTRMACSVGTY----------------M 370
            ||:                  .:|.|....:|::       || :||.                :
  Fly   220 LHRNLSYTARRINKHYGPQMLAMRFDYFIFSIIN-------AC-IGTIYSTTDQEPSLEKIFGSL 276

  Fly   371 IYSIQFIPKFSNTYM 385
            ||.::....|.|.|:
  Fly   277 IYWVRSFDFFLNDYI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 60/329 (18%)
Gr59aNP_726287.2 7tm_7 7..363 CDD:285581 63/340 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.