DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr8a and Gr77a

DIOPT Version :9

Sequence 1:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_730560.1 Gene:Gr77a / 117476 FlyBaseID:FBgn0045474 Length:449 Species:Drosophila melanogaster


Alignment Length:343 Identity:67/343 - (19%)
Similarity:118/343 - (34%) Gaps:95/343 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GHLGRVLQFHLRLYQVLGFHGLPLPGDGNPARTRRRLMAWSLFLLISLSALVLAC-----LFSGE 62
            |.|.|:|:...||.:::  |...|....:...|:..|    |.:::.||:.:|:.     :...:
  Fly   135 GCLNRLLKCRRRLRRLM--HTRKLKDSMDCLATKGHL----LEVVVLLSSYLLSMAQPIQILKDD 193

  Fly    63 EFLYRGDMFGCANDALKYVFAELGVLAIYL----------------------ETLSSQRHL---- 101
            ..:.|..|:.|   :|.:|.....:|.:.|                      :.|:...|:    
  Fly   194 PEVRRNFMYAC---SLVFVSVCQAILQLSLGMYTMAILFLGHLVRHSNLLLAKILADAEHIFESS 255

  Fly   102 --ANFW------------WLHFKLGGQKTGLVSLRSEFQQFCRYLIFLYAMMAA--------EVA 144
              |.||            ||..:|    ..|:.:..:..:..|.:..|.|:.|.        |..
  Fly   256 QKAGFWPNRQELYKGQQKWLALEL----WRLLHVHHQLLKLHRSICSLCAVQAVCFLGFVPLECT 316

  Fly   145 IHLGLWQFQALTQHMLLFWSTYEPLVW--LTYL----RNLQFVLHLELLREQLTGLEREM---GL 200
            |||....|...::.:|..:....||.:  :.:|    .||..|:......|:.....||:   |.
  Fly   317 IHLFFTYFMKYSKFILRKYGRSFPLNYFAIAFLVGLFTNLLLVILPTYYSERRFNCTREIIKGGG 381

  Fly   201 LAEYSRFASETGRSFPGFESFLRRRLVQKQRIYSHVYDMLKC----FQGAFNFSILAVLLTINIR 261
            ||..||...:..|....|.....:.:       .||:.:..|    ...|..|.|:..:|.    
  Fly   382 LAFPSRITVKQLRHTMHFYGLYLKNV-------EHVFAVSACGLFKLNNAILFCIVGAILE---- 435

  Fly   262 IAVDCYFMYYSIYNNVIN 279
                 |.|....::.|:|
  Fly   436 -----YLMILIQFDKVLN 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 64/337 (19%)
Gr77aNP_730560.1 7tm_7 37..444 CDD:285581 65/337 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.