DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr8a and Gr59d

DIOPT Version :9

Sequence 1:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_611758.2 Gene:Gr59d / 117343 FlyBaseID:FBgn0041236 Length:390 Species:Drosophila melanogaster


Alignment Length:413 Identity:77/413 - (18%)
Similarity:143/413 - (34%) Gaps:132/413 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GHLGRVLQFHLRLYQVLGFHGLPLPGDGNPARTRRRLMAWSLFLL-ISLSALVLACLFSGEEFLY 66
            |.|..|:.|.:.|                  :|.:.|:.....|: :|...|:.|.|      ||
  Fly    16 GRLTGVINFKIDL------------------KTGQALVTRGATLISVSTHLLIFALL------LY 56

  Fly    67 R-------GDMFGCANDALKYVF---AELGVLAIYLETLSSQRHLANFWWLHFKLGGQKTGLVSL 121
            :       ..|:..||...:|||   |...|:.::||.:|.        |      .|:...|.|
  Fly    57 QTMRKSVVNVMWKYANSLHEYVFLVIAGFRVVCVFLELVSR--------W------SQRRTFVRL 107

  Fly   122 RSEFQ----------QFCR----------------YLIFLYAMM--AAEVAIHLGLWQFQALTQH 158
            .:.|:          |:||                ::|...|||  ...:|:.|.:|...:||..
  Fly   108 FNSFRRLYQRNPDIIQYCRRSIVSKFFCVTMTETLHIIVTLAMMRNRLSIALALRIWAVLSLTAI 172

  Fly   159 MLLFWSTYEPLVWLTYLRNLQFVLHLELLREQLTGLEREMGLLAEYSRFASETGRSFPGFESFLR 223
            :.:..:.|  .|....:|....:|:.:|           ..::.|........|..|.....:|.
  Fly   173 INVIITQY--YVATACVRGRYALLNKDL-----------QAIVTESQSLVPNGGGVFVTKCCYLA 224

  Fly   224 RRLVQKQRIYSHVYDMLKCFQGAFNFSILAVLLTINIRIAVDCYFMY-YSIYNNVINNDYYLIVP 287
            .||.:..:..|.:.::::....|:...::.:::|..:.:....|.:: .|.|.|..||  .|::.
  Fly   225 DRLERIAKSQSDLQELVENLSTAYEGEVVCLVITYYLNMLGTSYLLFSISKYGNFGNN--LLVII 287

  Fly   288 ALLEIPAFIYASQSCMV------------------------VVPRIAHQLHNIVTDSGCCSCPDL 328
            .|..|..|::....|.:                        ..|.:.|:|..:            
  Fly   288 TLCGIVYFVFYVVDCWINAFNVFYLLDAHDKMVKLLNKRTLFQPGLDHRLEMV------------ 340

  Fly   329 SLQIQNFSLQLLHQPIRIDCLGL 351
               .:||:|.|:..|:::...||
  Fly   341 ---FENFALNLVRNPLKLHMYGL 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 74/407 (18%)
Gr59dNP_611758.2 7tm_7 9..389 CDD:285581 77/413 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.