DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31251 and Rtraf

DIOPT Version :9

Sequence 1:NP_732260.2 Gene:CG31251 / 318645 FlyBaseID:FBgn0051251 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_080804.1 Gene:Rtraf / 68045 MGIID:1915295 Length:244 Species:Mus musculus


Alignment Length:168 Identity:34/168 - (20%)
Similarity:59/168 - (35%) Gaps:58/168 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 KFSPSDYKNGDVFETHCWSQT--------LKDVEVQALLPKDHQTAKKLHISIQAQHIKVSSKHS 179
            |.:..||.|...|  :|..:|        |:|.:::....:|....:.:|.|...:..       
Mouse     5 KLTALDYHNPSGF--NCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFF------- 60

  Fly   180 PETIILEGNLSQRIK-HKEAV-WTIDQNRLIISYDKAKELWWDRLFEGDPEIDSKKIECERYIDD 242
             |..:.:.|...:|: .:||: |.:.   |.:           ||..||        ..|:|.|.
Mouse    61 -EKYLKDVNCPFKIQDRQEAIDWLLG---LAV-----------RLEYGD--------NAEKYKDL 102

  Fly   243 LPEETQATIEKLRVQQLAADKQQNEIQTSSPDQAINLD 280
            :|:..:.|              .|..:.:.|  .||||
Mouse   103 VPDNRKNT--------------DNAAKNAEP--LINLD 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31251NP_732260.2 Nudc_N 5..64 CDD:290757
p23_NUDC_like 139..223 CDD:107224 15/93 (16%)
RtrafNP_080804.1 RLL 8..243 CDD:401864 33/165 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4380
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.