DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31251 and Nudcd2

DIOPT Version :9

Sequence 1:NP_732260.2 Gene:CG31251 / 318645 FlyBaseID:FBgn0051251 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_080299.4 Gene:Nudcd2 / 52653 MGIID:1277103 Length:157 Species:Mus musculus


Alignment Length:118 Identity:28/118 - (23%)
Similarity:54/118 - (45%) Gaps:19/118 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 WSQTLKDVEVQALLPKDHQTAKKLHISIQAQHI--KVSSKHSPETIILEGNLSQRIKHKEAVWTI 202
            |.|||::|.::..:|...: |:.:...:|::|:  .|..:.     ||:|.|.......|..||:
Mouse    21 WYQTLEEVFIEVQVPPGTR-AQDIQCGLQSRHVALAVGGRE-----ILKGKLFDSTIADEGTWTL 79

  Fly   203 DQN---RLIISYDK--AKELWWDRL---FEGDPEID---SKKIECERYIDDLP 244
            :..   |::::..|  |...|...|   :..||.:.   .:|:..||:..:.|
Mouse    80 EDRKMVRIVLTKTKRDAANCWTSLLESEYAADPWVQDQMQRKLTLERFQKENP 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31251NP_732260.2 Nudc_N 5..64 CDD:290757
p23_NUDC_like 139..223 CDD:107224 22/92 (24%)
Nudcd2NP_080299.4 p23_NUDCD2_like 12..104 CDD:107243 21/88 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..157
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.