DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31251 and nudcd3

DIOPT Version :9

Sequence 1:NP_732260.2 Gene:CG31251 / 318645 FlyBaseID:FBgn0051251 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_998356.1 Gene:nudcd3 / 406472 ZFINID:ZDB-GENE-040426-2255 Length:344 Species:Danio rerio


Alignment Length:340 Identity:99/340 - (29%)
Similarity:160/340 - (47%) Gaps:61/340 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DAMLMEILQDRKTITGFLDSIFGFLRRNTDFYHTKRDEADKIGFPKGVRDQI------LYGAMQR 65
            |..|:.|||....:..||...||||.|.||||.......|::|||.|..:|:      |:..:..
Zfish    12 DNALLGILQHVGNVQNFLQVYFGFLYRKTDFYRLLSGPHDRMGFPPGAAEQMVFKTFKLFEKLAE 76

  Fly    66 YDPDCLLQSLTAEGGADDGETAPPAVEEVVLESEDGPQDEEMKPIE-----------SQPPQKGK 119
            .|.:..::.:..:..|     |||||:|:.|:||    .:|.:..|           |.......
Zfish    77 QDRERTVKLMEEKSAA-----APPAVQELELQSE----TQESRETEDNTAASASSSASAASLSST 132

  Fly   120 EQSKFSPSDYK----------------------NGDVFETHCWSQTLKDVEVQALLPKDHQTAKK 162
            ::|:.:|.|..                      ||.|.|.:.|||...||||:..:..|....::
Zfish   133 DESRNTPDDNSSGAEKTADADKDNVAQANADSYNGAVREKYTWSQDYTDVEVRVHVEPDIIKGRQ 197

  Fly   163 LHISIQAQHIKVS-SKHSPETIILEGNLSQRIKHKEAVWTIDQNR-LIISYDKAKELWWDRLFEG 225
            :.:.:|:..:.|| :......::|:|..:.||..:.::|:::..| :::|..|..|:||..:.:|
Zfish   198 VCVDLQSSRVCVSVADGGSRKVLLDGEFTHRINTENSLWSLEPGRCVLLSLSKCSEVWWSAVLKG 262

  Fly   226 DPEIDSKKIECERYIDDLPEETQATIEKLRV---QQLAADKQQNEIQTSSPDQAINLDRLKAAWD 287
            :.|||..:|..||.:..:.||..|.:::|..   |:|....|.:|::..        |.||..||
Zfish   263 EAEIDVNQINRERSMATVDEEEHAVLDRLTFDYHQKLQGKPQSHEMKVH--------DMLKKGWD 319

  Fly   288 AEGSPFKGQPFDPSI 302
            |||||||||.||||:
Zfish   320 AEGSPFKGQEFDPSM 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31251NP_732260.2 Nudc_N 5..64 CDD:290757 23/62 (37%)
p23_NUDC_like 139..223 CDD:107224 22/85 (26%)
nudcd3NP_998356.1 Nudc_N 11..69 CDD:290757 22/56 (39%)
p23_NUDCD3_like 167..268 CDD:107244 28/100 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596371
Domainoid 1 1.000 68 1.000 Domainoid score I9722
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H9097
Inparanoid 1 1.050 144 1.000 Inparanoid score I4429
OMA 1 1.010 - - QHG60150
OrthoDB 1 1.010 - - D1489576at2759
OrthoFinder 1 1.000 - - FOG0009062
OrthoInspector 1 1.000 - - oto39039
orthoMCL 1 0.900 - - OOG6_106504
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6798
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.