DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31251 and rtraf

DIOPT Version :9

Sequence 1:NP_732260.2 Gene:CG31251 / 318645 FlyBaseID:FBgn0051251 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_956564.2 Gene:rtraf / 393240 ZFINID:ZDB-GENE-040426-1082 Length:242 Species:Danio rerio


Alignment Length:142 Identity:34/142 - (23%)
Similarity:50/142 - (35%) Gaps:55/142 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 VWTIDQN------------RLIISYDKAKELWWDRLFEGDPEIDSKKIECERYIDDL-----PEE 246
            ||..||.            |.|.|.|      |.:.|             |:|:.|:     .:|
Zfish    30 VWLEDQKIRHYKIEDRGNLRNIPSSD------WPKYF-------------EKYLQDVNCPFSVQE 75

  Fly   247 TQATIEKL-----------RVQQLAADK---QQNEIQTSSPDQAINLDR----LKAAWDAEGSPF 293
            .|.|::.|           .|::....|   :.|::|.|: |..||||.    .||...|..:..
Zfish    76 RQETVDWLLGLAVRFEYGDNVEKYRNCKPVTETNDVQKSA-DPLINLDSNNPDFKAGVLALANLL 139

  Fly   294 KGQPFDPSIVRM 305
            |.|..|..:|.:
Zfish   140 KIQRHDDYLVML 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31251NP_732260.2 Nudc_N 5..64 CDD:290757
p23_NUDC_like 139..223 CDD:107224 9/35 (26%)
rtrafNP_956564.2 RLL 5..241 CDD:287054 34/142 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4380
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.