DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31251 and SPBC19F8.02

DIOPT Version :9

Sequence 1:NP_732260.2 Gene:CG31251 / 318645 FlyBaseID:FBgn0051251 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_596344.1 Gene:SPBC19F8.02 / 2540736 PomBaseID:SPBC19F8.02 Length:166 Species:Schizosaccharomyces pombe


Alignment Length:150 Identity:47/150 - (31%)
Similarity:82/150 - (54%) Gaps:15/150 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 QSKFSPSDYKNGDVFETHCWSQTLKDVEVQALLPKDHQTAKKLHISIQAQHIKVSSKHSPETIIL 185
            |.|...::|:         |.||:.||::...:||..: ||.|.:.:....:|:........::|
pombe     3 QVKLEEAEYE---------WDQTIADVDIVIHVPKGTR-AKSLQVDMSNHDLKIQINVPERKVLL 57

  Fly   186 EGNLSQRIKHKEAVWTI-DQNRLIISYDKAKEL-WWDRLFEGDPEIDSKKIECER-YIDDLPEET 247
            .|.|.::|...|:.||: :|.||:|..:|:.:: ||..:.:|.|.||...||.|. .:.||.|||
pombe    58 SGPLEKQINLDESTWTVEEQERLVIHLEKSNKMEWWSCVIKGHPSIDIGSIEPENSKLSDLDEET 122

  Fly   248 QATIEKLRVQQLAADKQQNE 267
            :||:||:.::|  :.|:.:|
pombe   123 RATVEKMMLEQ--SQKRTDE 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31251NP_732260.2 Nudc_N 5..64 CDD:290757
p23_NUDC_like 139..223 CDD:107224 25/85 (29%)
SPBC19F8.02NP_596344.1 p23_NUDC_like 11..97 CDD:107224 26/95 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12356
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.