DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31251 and NUDCD3

DIOPT Version :9

Sequence 1:NP_732260.2 Gene:CG31251 / 318645 FlyBaseID:FBgn0051251 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_056147.2 Gene:NUDCD3 / 23386 HGNCID:22208 Length:361 Species:Homo sapiens


Alignment Length:355 Identity:103/355 - (29%)
Similarity:175/355 - (49%) Gaps:64/355 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DAMLMEILQDRKTITGFLDSIFGFLRRNTDFYHTKRDEADKIGFPKGVRDQIL------YGAMQR 65
            |..|:.|||....:..||..:||||.|.||||...|..:|::|||.|....::      :..|.|
Human    10 DQALLGILQHVGNVQDFLRVLFGFLYRKTDFYRLLRHPSDRMGFPPGAAQALVLQVFKTFDHMAR 74

  Fly    66 YDPDCLLQSL-------------TAEGGADDGETAPPAVEEVVLESE---DGPQD-EEMKP---- 109
            .|.:...|.|             |....|.:.|..|..|:|:.::|.   ||.|: |:::|    
Human    75 QDDEKRRQELEEKIRRKEEEEAKTVSAAAAEKEPVPVPVQEIEIDSTTELDGHQEVEKVQPPGPV 139

  Fly   110 ---------------------IESQPP--QKGKEQSKFSPSDYKNGDVFETHCWSQTLKDVEVQA 151
                                 :..:||  .:.:||.:.:|..| ||.|.|.:.|||...|:||:.
Human   140 KEMAHGSQEAEAPGAVAGAAEVPREPPILPRIQEQFQKNPDSY-NGAVRENYTWSQDYTDLEVRV 203

  Fly   152 LLPKDHQTAKKLHISIQAQHIKVSS-KHSPETIILEGNLSQRIKHKEAVWTIDQNR-LIISYDKA 214
            .:||.....|::.:::.:..|:|:. :.:.|.:::||.|:.:|..:.::|:::..: ::::..|.
Human   204 PVPKHVVKGKQVSVALSSSSIRVAMLEENGERVLMEGKLTHKINTESSLWSLEPGKCVLVNLSKV 268

  Fly   215 KELWWDRLFEGDPEIDSKKIECERYIDDLPEETQATIEKLRV---QQLAADKQQNEIQTSSPDQA 276
            .|.||:.:.||:..||..||..||.:..:.||.||.:::|..   |:|....|.:|::..     
Human   269 GEYWWNAILEGEEPIDIDKINKERSMATVDEEEQAVLDRLTFDYHQKLQGKPQSHELKVH----- 328

  Fly   277 INLDRLKAAWDAEGSPFKGQPFDPSIVRMS 306
               :.||..||||||||:||.|||::..:|
Human   329 ---EMLKKGWDAEGSPFRGQRFDPAMFNIS 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31251NP_732260.2 Nudc_N 5..64 CDD:290757 22/62 (35%)
p23_NUDC_like 139..223 CDD:107224 21/85 (25%)
NUDCD3NP_056147.2 Nudc_N 9..67 CDD:290757 22/56 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..106 2/18 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..158 5/33 (15%)
p23_NUDCD3_like 184..285 CDD:107244 27/100 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160062
Domainoid 1 1.000 68 1.000 Domainoid score I9762
eggNOG 1 0.900 - - E1_KOG2265
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H9097
Inparanoid 1 1.050 149 1.000 Inparanoid score I4394
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60150
OrthoDB 1 1.010 - - D1489576at2759
OrthoFinder 1 1.000 - - FOG0009062
OrthoInspector 1 1.000 - - oto89999
orthoMCL 1 0.900 - - OOG6_106504
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5173
SonicParanoid 1 1.000 - - X6798
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.700

Return to query results.
Submit another query.