DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31251 and NUDC

DIOPT Version :9

Sequence 1:NP_732260.2 Gene:CG31251 / 318645 FlyBaseID:FBgn0051251 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_016855583.1 Gene:NUDC / 10726 HGNCID:8045 Length:392 Species:Homo sapiens


Alignment Length:385 Identity:80/385 - (20%)
Similarity:141/385 - (36%) Gaps:140/385 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TGFLDSIFGFLRRNTDFYHTKRDEADKIGFPKGVRDQILYGAMQRYDPDC--------------- 70
            |..:::.|.||||.|||:         ||..:|:.::|     .|.:.:|               
Human    30 TVLVNTFFSFLRRKTDFF---------IGGEEGMAEKI-----GRRENECQQKKCQTLIKPSDLV 80

  Fly    71 --------------LLQSLTAEGGADD-------------------------------------- 83
                          |:..|...|.|.|                                      
Human    81 RTHSYHENSMGETILVIQLPPPGTAFDMWELQFKLITQTFSHHNQLAQKTRREKRARQEAERREK 145

  Fly    84 ------------GETAPPAVEEVVLESED---------------------------GPQDEEMKP 109
                        .||:.|.::|:..|..:                           |.||.|...
Human   146 AERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDE 210

  Fly   110 IESQPPQKGKEQSKFSPSDYKNGDVFETHCWSQTLKDVEVQALLPKDHQ-TAKKLHISIQAQHIK 173
            .|.:     |::.|..| :..||.....:.|:|||.::::......:.: ..|.:.:.||.:|::
Human   211 EEDE-----KDKGKLKP-NLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLR 269

  Fly   174 VSSKHSPETIILEGNLSQRIKHKEAVWTIDQNRLI-ISYDKAKEL-WWDRLFEGDPEIDSKKIEC 236
            |..|..|  .|::|.|...:|.:|:.|.|:..::: :..:|..:: ||.||...||||::|||..
Human   270 VGLKGQP--AIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINP 332

  Fly   237 ER-YIDDLPEETQATIEKLRVQQ--------LAADKQQNEIQTSSPDQAINLDRLKAAWD 287
            |. .:.||..||::.:||:...|        .:.::::.||.....||...:|..||.::
Human   333 ENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31251NP_732260.2 Nudc_N 5..64 CDD:290757 13/42 (31%)
p23_NUDC_like 139..223 CDD:107224 22/86 (26%)
NUDCXP_016855583.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12356
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.