DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31251 and Nudcd3

DIOPT Version :9

Sequence 1:NP_732260.2 Gene:CG31251 / 318645 FlyBaseID:FBgn0051251 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_038947459.1 Gene:Nudcd3 / 100125378 RGDID:1642416 Length:363 Species:Rattus norvegicus


Alignment Length:357 Identity:104/357 - (29%)
Similarity:164/357 - (45%) Gaps:66/357 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DAMLMEILQDRKTITGFLDSIFGFLRRNTDFYHTKRDEADKIGFPKGVRDQIL------YGAMQR 65
            |..|:.|||....:..||..:||||.|.||||...|...|::|||.|....::      :..|.|
  Rat    10 DQALLGILQHVGNVQDFLRVLFGFLYRKTDFYRLLRHPTDRMGFPPGAAQALVLQVFKTFDHMAR 74

  Fly    66 YDPDCLLQSL-----------------TAEGGA---------DDGETAPPAVEEVVLESEDGPQD 104
            .|.:...:.|                 |||..|         .|..||.....||..|...|||.
  Rat    75 QDDEKRKKELEEKIRKKEEEAKAVAAATAEKEAVPVPVQEVEIDATTALSGPREVEKEELPGPQG 139

  Fly   105 EEMKPIE------------------SQPPQKGKEQSKF--SPSDYKNGDVFETHCWSQTLKDVEV 149
            .|.|...                  ..||...:.|.:|  :|..| ||.:.|.:.|||...|:||
  Rat   140 PERKVTHGSEEAEAPGTASSAAEGPKDPPVLPRIQEQFQKNPDSY-NGAIRENYTWSQDYTDLEV 203

  Fly   150 QALLPKDHQTAKKLHISIQAQHIKVSS-KHSPETIILEGNLSQRIKHKEAVWTIDQNR-LIISYD 212
            :..:||.....|::.:::.:..|:|:. :.:.|.:::||.|:.:|..:.::|:::..: ::::..
  Rat   204 RVPVPKHVVKGKQVSVALSSGSIRVAMLEENGERVLMEGKLTHKINTESSLWSLEPGKCVLVNLS 268

  Fly   213 KAKELWWDRLFEGDPEIDSKKIECERYIDDLPEETQATIEKLRV---QQLAADKQQNEIQTSSPD 274
            |..|.||..:.||:..||..||..||.:..:.||.||.:::|..   |:|....|.:|::..   
  Rat   269 KVGEYWWSAILEGEEPIDIDKINKERSMATVDEEEQAVLDRLTFDYHQKLQGKPQSHELKVH--- 330

  Fly   275 QAINLDRLKAAWDAEGSPFKGQPFDPSIVRMS 306
                 :.||..||||||||:||.|||::..:|
  Rat   331 -----EMLKKGWDAEGSPFRGQRFDPAMFNIS 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31251NP_732260.2 Nudc_N 5..64 CDD:290757 22/62 (35%)
p23_NUDC_like 139..223 CDD:107224 21/85 (25%)
Nudcd3XP_038947459.1 Nudc_N 9..67 CDD:404860 22/56 (39%)
p23_NUDCD3_like 186..287 CDD:107244 26/100 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11844
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1489576at2759
OrthoFinder 1 1.000 - - FOG0009062
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106504
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6798
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.