DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94f and Ir87a

DIOPT Version :9

Sequence 1:NP_732868.2 Gene:Ir94f / 318632 FlyBaseID:FBgn0051225 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster


Alignment Length:261 Identity:50/261 - (19%)
Similarity:93/261 - (35%) Gaps:109/261 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 SGLKIRGMRGEF-----------------MEYPIDMRSRYASSFLLHDLFFDLAQYRNSLNTSY- 423
            ||.::|.:.|.|                 .::||.:|..:|.|||:.  ||....|::.|.::. 
  Fly   523 SGFQLRNLNGYFPTCLRVLGILLNQAIPAQDFPITLRQLFALSFLMG--FFFSNTYQSFLISTLT 585

  Fly   424 ----GYTVTSVKWELY---------KEAQRHFRR--PLFRY--------------------SEEI 453
                .|.:.::: |:|         .|..||..:  .:|:|                    :|.|
  Fly   586 TPRSSYQIHTLQ-EIYSNKMTVMGTSEHVRHLNKDGEIFKYIREKFQMCYNLVDCLNDAAQNEHI 649

  Fly   454 CV---QKLSLFSLIQQSNCIYCYRSR----IFILRM-----------------H--EAGLIRLWY 492
            .|   ::.|.::...|.:.:||:..|    ::::.|                 |  |:|.::.|.
  Fly   650 AVAVSRQHSFYNPRIQRDRLYCFDRRESLYVYLVTMLLPKKYHLLHQINPVIQHIIESGHMQKWA 714

  Fly   493 RRSYYVMVTAGRFPIGDLS---TVH------RAQPIR---WTEWQNVVLLHGVGLLFSVVVFVIE 545
            |               ||.   .:|      |..|.:   :.:::..:...|..||.:..||..|
  Fly   715 R---------------DLDMRRMIHEEITRVREDPFKALTFDQFRGAIAFSGGLLLVASCVFAFE 764

  Fly   546 L 546
            |
  Fly   765 L 765

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir94fNP_732868.2 None
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.