DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94f and Ir68b

DIOPT Version :9

Sequence 1:NP_732868.2 Gene:Ir94f / 318632 FlyBaseID:FBgn0051225 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_648548.1 Gene:Ir68b / 39378 FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster


Alignment Length:485 Identity:93/485 - (19%)
Similarity:166/485 - (34%) Gaps:165/485 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 PY--KLGNLKGHPIR----TVPDNSEPLTIVRKTLNGSIAIDGLVWQFMIEFAKHINATLQLPIE 235
            ||  |:.:|:|:|:|    |.|..:.|.:.|...  |..|:||:..:.:.|.   :||::.... 
  Fly   180 PYARKVKDLRGYPLRFSMFTDPLMAMPRSPVETA--GYQAVDGVAARVVGEM---LNASVTYVF- 238

  Fly   236 PHPEKSIKLVQIL----------DLVRNQT----------------VDIAASLRPYSLNVQRSST 274
              ||.:....:.|          |:|...|                |::   |.||:    |.:.
  Fly   239 --PEDNESYGRCLPNGNYTGVVSDIVGGHTHFAPNSRFVLDCIWPAVEV---LYPYT----RRNL 294

  Fly   275 HIYGSPMMVGN-------------WCMMLPTERVI----GSHEALTR------LMKSPWTWL-IL 315
            |:......:..             |.::|.|..|:    ...:.|.|      :::...||. ||
  Fly   295 HLVVPASAIQPEYLIFVRVFRRTVWYLLLVTLLVVVLVFWVMQRLQRRIPRRGVIQFQATWYEIL 359

  Fly   316 LLFYSVH-----RFLAQKTRLRSSLIHLIKLLINLSLICFLQAQLSAYFIGP---QKVNHISNMQ 372
            .:|...|     ..|:..:.:|:.|:..|.....||.|.|  |:|.:.|:.|   ::|:.:.::.
  Fly   360 EMFGKTHVGEPAGRLSSFSSMRTFLMGWILFSYVLSTIYF--AKLESGFVRPSYEEQVDRVDDLV 422

  Fly   373 QVEESGLKIRGM----RGEFMEY----------------------PIDMRSRYASSFLLHDLFFD 411
            .::.....:..|    |....|:                      |:..|....::|::.|.   
  Fly   423 HLDVHIYAVTTMYDAVRSALTEHQYGLLENRSRQLPLGIATSYYQPVVRRRDRRAAFIMRDF--- 484

  Fly   412 LAQYRNSLNTSYGYTVTSVKWELYKEAQRHFRRPLFRYSEEICVQKLSLFSLIQQSNCIYCY-RS 475
              ..|:.|..:|             ::|.  .||.:..:.|.      |.|:|    |.|.. |.
  Fly   485 --HARDFLAITY-------------DSQA--ERPAYHIAREY------LRSMI----CTYILPRG 522

  Fly   476 RIFILRMH-------EAGLIRLWYRRSYYVMVTAGRFP--------IGD----------LSTVHR 515
            ..|:.|:.       |.|....|  |...::...|..|        :||          |:..::
  Fly   523 SPFLHRLESLYSGFLEHGFFEHW--RQMDLITRVGASPDAEEFLEDLGDQTDTDSGSNELAIRNK 585

  Fly   516 AQPIRWTEWQNVVLLHGVGLLFSVVVFVIE 545
            ...:.....|....|..||:..|.:.|.:|
  Fly   586 KVVLTLDILQGAFYLWSVGIGISCLGFAVE 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir94fNP_732868.2 None
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489 56/307 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.