DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94f and Ir67b

DIOPT Version :9

Sequence 1:NP_732868.2 Gene:Ir94f / 318632 FlyBaseID:FBgn0051225 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_648393.1 Gene:Ir67b / 39194 FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster


Alignment Length:482 Identity:99/482 - (20%)
Similarity:188/482 - (39%) Gaps:152/482 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 TLFPY---KLGNLKGHPIRTVPDNSEPLTIVRK--TLNGSIAIDGLV------W----------- 216
            |..||   |:.|||        ...|..::.||  .|||.....|||      |           
  Fly   147 TFMPYQDLKILNLK--------SIKEFYSLSRKKMDLNGYNITSGLVIAGAPRWFSFRDRQNRLI 203

  Fly   217 ------QFMIEFAKHINATLQLPIEPHPEKSIKLVQI------LDLVRNQTVD----IAASLRPY 265
                  :.:::|..|.|.            |::|:.:      |:|:.|:|:|    :...|:.:
  Fly   204 LTGYMLRMIVDFTNHFNG------------SVRLMNVLTVNDGLELLANRTIDFFPFLIRPLKSF 256

  Fly   266 SLNVQRSSTHIYGSPMMVGNWCMMLPTERVIGSHEALTR-LMKSPW-TWLILLLFYSVH-RFLAQ 327
            |:     |..:|     :.|..:::||.|.:.:...|.| .....| .|||:|::.|:. |.|::
  Fly   257 SM-----SNILY-----LENCGLIVPTSRPLPNWVYLLRPYAFDTWIAWLIMLIYCSLALRILSK 311

  Fly   328 -KTRLRSSLIHLIKLLINLS-------------LICFL-------------QAQLSAYFIGPQKV 365
             :..:.::.:.:::|::.||             |..|:             .||||:........
  Fly   312 GQISISAAFLKVLRLVMYLSGSRDMGTRPTTRRLFLFVILTTSGFILTNLYVAQLSSNSAAGLYE 376

  Fly   366 NHISNMQQVEES-------GLKIRGMRGEFMEYPIDMRSRYASSFLLHDLFFDLAQYRNSLNTS- 422
            ..|:..:.:::|       .:.|:     .||..|..|::.... ::..|..|:..||.:|||| 
  Fly   377 KQINTWEDLDKSDSIWPLIDVDIK-----TMEKLIPDRTKLLKK-IVPTLEADVDTYRRNLNTSC 435

  Fly   423 -YGYTVTSVKWELYKEAQRHFRRPLFRYSEEICVQK------------LSLFSLIQQSNCIYCYR 474
             :......:.:.||:  |:..|.|:||....:..|:            |.||:.           
  Fly   436 IHSGFFDRIDFALYQ--QKFLRFPIFRKFPHLLYQQPLQISAAFGRPYLQLFNW----------- 487

  Fly   475 SRIFILRMHEAGLIRLWYRRSYYVMVTAGRFPIGDLSTVHRAQPIRWTEWQNVVLLHGV---GLL 536
               |:.::.|:|:.......:|...:.:|   :.:|:...|...::..:.:...|:.|:   ||.
  Fly   488 ---FVRKIFESGIYLKMKDDAYRHGIQSG---LLNLAFRDRHLEVKSNDVEYYYLIAGLWFGGLT 546

  Fly   537 FSVVVFVIELTVHYANV-----CLNNL 558
            .:.|.|::||.:.||.:     |..|:
  Fly   547 LATVCFLLELLIGYAKIKVTISCKMNI 573



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.