DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94f and Ir60a

DIOPT Version :9

Sequence 1:NP_732868.2 Gene:Ir94f / 318632 FlyBaseID:FBgn0051225 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_611901.1 Gene:Ir60a / 37881 FlyBaseID:FBgn0034994 Length:716 Species:Drosophila melanogaster


Alignment Length:404 Identity:72/404 - (17%)
Similarity:130/404 - (32%) Gaps:136/404 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 INATLQLPIEPHPEKSIKLVQILDLVRNQTVD-IAASLRPYSLNVQRSSTHIYGSPMMVGN---W 286
            :|.|..|......:.......:|..|:|...| :.....|.:    ..:.|.:||...:.:   |
  Fly   306 VNQTCSLESRGEMDGPANWTGLLGKVQNNECDFVFGGYYPDN----EVADHFWGSDTYLQDAHTW 366

  Fly   287 CMMLPTER-----VIGSHEALTRLMKSPWTWLILLLFYS-------------------------- 320
            .:.:...|     ::|..||.|      |...||:|..|                          
  Fly   367 YIKMADRRPAWQALVGIFEAYT------WIGFILILIISWLFWFTLVMILPEPKYYQQLSLTAIN 425

  Fly   321 ----------VHRFLAQKTRLRSSLIHLIKLLINLSLICFLQAQLSAYFIGPQKVNHISNMQQVE 375
                      ..|.:.:.||    |..:...|..|:::....:::.|.|..|..::.:..:.:|.
  Fly   426 ALAVTISIAVQERPICETTR----LFFMALTLYGLNVVATYTSKMIATFQDPGYLHQLDELTEVV 486

  Fly   376 ESGLKIRGMR--GEFMEYPIDMRSRYASSFLLHDLFFDLAQYRNSLNTSYGYTVTSVKWELYKEA 438
            .:|:...|..  .::.|...||.           :|       |..|.|..:...|...|..|..
  Fly   487 AAGIPFGGHEESRDWFENDDDMW-----------IF-------NGYNISPEFIPQSKNLEAVKWG 533

  Fly   439 QRHFRRPLFRYSEEICVQKLSLFSLIQQS---NCIYCYRSRIF--------------------IL 480
            ||             |:....::::  ||   :.||.:.:.:|                    |:
  Fly   534 QR-------------CILSNRMYTM--QSPLADVIYAFPNNVFSSPVQMIMKAGFPFLFEMNSII 583

  Fly   481 R-MHEAGLIR-----LWYRRSYYVMVTAGR--FPIGD--LSTVHRAQPIRWTEWQNVVLLHGVGL 535
            | |.:.|:.:     ..|..:|...:...|  ||...  |:|.|...|.       .:|:  ||.
  Fly   584 RLMRDVGIFQKIDADFRYNNTYLNRINKMRPQFPETAIVLTTEHLKGPF-------FILV--VGS 639

  Fly   536 LFSVVVFVIELTVH 549
            .::.:.|:.||.:|
  Fly   640 CWAALTFIGELIIH 653



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.