DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and hgfa

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_005164799.1 Gene:hgfa / 493781 ZFINID:ZDB-GENE-041014-2 Length:712 Species:Danio rerio


Alignment Length:287 Identity:68/287 - (23%)
Similarity:105/287 - (36%) Gaps:79/287 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIFNEKQYNSDN--IIAEPTEHPWV---VRIVG-----VTKDGS--------NTLLCTGILIDS 75
            ||:...|..:||:  :...|....::   .||||     ..:|||        |...|.|.||..
Zfish   446 CGLERCKSMSSDDHQMSGGPKPSCFIHKTTRIVGGMRVQRAEDGSWVVSIQKGNRHWCGGSLIRE 510

  Fly    76 RRVVTAAHCVS---KDESESIYGVVFG-----DSDSSNINLVSAVTVHPDYSPRKFENDLAIIEL 132
            ..|:|...|.|   .|.||  |.|..|     .|..:....::.|...|:.|      :||:::|
Zfish   511 EWVLTDQQCFSTCVPDLSE--YTVQVGLLHLNASAGTQALRIAHVVCGPEGS------NLALLKL 567

  Fly   133 TKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAGLEGPSFDRRHSATQRL-------DKR--- 187
            |.....|:.|:.:.||     |.|...:...|.:....|.:....|..:.::       :||   
Zfish   568 TTPAPLSEHVRTVQLP-----VAGCAVAEGTLCLMYGWGDTKGTGHEGSLKMVGLPIVSNKRCSQ 627

  Fly   188 -----IKMTYTKI------DSKECHEKQARFPEELICGHTERSPLSGSALTEASGTPRQFHLLGI 241
                 :.:|.|||      |...| ||....|  |:|...|...:.|.::...          |.
Zfish   628 SHNGILPITETKICAGGKRDQGVC-EKDYGGP--LVCQEGESKVIVGVSINGR----------GC 679

  Fly   242 AVAGFFSSDLDHQGYLNIRPHLDWISK 268
            |||      .....::|:..:.:||.|
Zfish   680 AVA------RRPAVFVNVAFYSEWIRK 700

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 38/147 (26%)
hgfaXP_005164799.1 PAN_AP_HGF <50..107 CDD:238532
KR 111..192 CDD:238056
KR 195..275 CDD:214527
KR 287..367 CDD:214527
KR 374..451 CDD:214527 2/4 (50%)
Tryp_SPc 476..698 CDD:214473 59/253 (23%)
Tryp_SPc 477..701 CDD:238113 61/256 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575867
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.