DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and Jon99Fi

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster


Alignment Length:239 Identity:59/239 - (24%)
Similarity:94/239 - (39%) Gaps:50/239 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 IVGVTKDGSNTLLCTGILIDSRRVVTAAHCVSKDESESI-YGVVFGDSDS-----SNINLVSAVT 113
            |||:...|:....|.|.:|.:..|:|||||.:.....:| ||....:...     .:.|.|.   
  Fly    52 IVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQYTHWVGSGNFVQ--- 113

  Fly   114 VHPDYSPRKFENDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAGLEG------- 171
             |..|:.....||:::|. |..|.|..||..:.|||.::..  .:.:....:.:|..|       
  Fly   114 -HHHYNSGNLHNDISLIR-TPHVDFWHLVNKVELPSYNDRY--QDYAGWWAVASGWGGTYDGSPL 174

  Fly   172 PSFDRRHSATQRLDKRIKMTYTKIDSKECHEKQARFPEELICGHTE--RSPLSGSALTEASGTPR 234
            |.:      .|.:|.:|      :...:| .:.....:.:||.:|.  :|...|.     ||.|.
  Fly   175 PDW------LQAVDVQI------MSQSDC-SRTWSLHDNMICINTNGGKSTCGGD-----SGGPL 221

  Fly   235 QFH----LLGIAVAGFFSSDLDHQG----YLNIRPHLDWISKNS 270
            ..|    |:|  |..|.||.....|    :..:..:||||..|:
  Fly   222 VTHEGNRLVG--VTSFVSSAGCQSGAPAVFSRVTGYLDWIRDNT 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 31/118 (26%)
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 56/233 (24%)
Tryp_SPc 38..262 CDD:238113 58/236 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.