DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG9737

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:305 Identity:80/305 - (26%)
Similarity:122/305 - (40%) Gaps:76/305 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ITTLHPTIQAASVGQECGIFNEKQ-----YNSDNIIAEPTEHPWVVRIVGVTKDGSNTLLCTGIL 72
            |.|:.|: ...::..|||    ||     |..:  |||..|.||:..:|    ..||...|:|.|
  Fly   127 IQTVEPS-SGFNLLNECG----KQVTNRIYGGE--IAELDEFPWLALLV----YNSNDYGCSGAL 180

  Fly    73 IDSRRVVTAAHCVSKD---ESESIYGVVFGD------------------SDSSNINLVSAVTVHP 116
            ||.|.::||||||..:   :.:.:..|..|:                  :|::.......:.|||
  Fly   181 IDDRHILTAAHCVQGEGVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHP 245

  Fly   117 DYSPRKFE----NDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAG-----LEGP 172
            :|  ::|.    ||:|||.|...|.|:..|.|||||:.||  |.:........|:|     |...
  Fly   246 EY--KEFSNYKYNDIAIIRLKHPVSFTHFVMPICLPNKSE--PLTLAEGQMFSVSGWGRTDLFNK 306

  Fly   173 SFDRRHSATQRLDKRIKMTYTKIDSKECHEKQARFPEEL----IC--GHTERSPLSGSALTEASG 231
            .|...||..     ::|:....:.::.|.:....|...|    ||  |...:...:|.     ||
  Fly   307 YFINIHSPI-----KLKLRIPYVSNENCTKILEGFGVRLGPKQICAGGEFAKDTCAGD-----SG 361

  Fly   232 TPRQFH--------LLGIAVAGFFSSDLDHQG--YLNIRPHLDWI 266
            .|..:.        ..|:...||....:..:.  |.|:..:.|||
  Fly   362 GPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 46/148 (31%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 70/276 (25%)
Tryp_SPc 150..409 CDD:238113 72/277 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.