DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and Jon99Ci

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:296 Identity:82/296 - (27%)
Similarity:119/296 - (40%) Gaps:68/296 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LTFL-----LTI--TTLHPTIQAASVGQECGIFNEKQYNSDNIIAEPTEHPWVVRIVGVT-KDGS 63
            |.||     ||:  :.:||.......|   ||  |.:..:.|:.:|..    |..||||: ....
  Fly     9 LAFLGVCSALTVPHSLVHPRDLEIRHG---GI--EGRITNGNLASEGQ----VPYIVGVSLNSNG 64

  Fly    64 NTLLCTGILIDSRRVVTAAHCVS-KDESESIYGVV------FGDSDSSNINLVSAVTVHPDYSPR 121
            |...|.|.:|....|:|||||.: .||:...||.|      |..:.||. |.:.    :|.|.  
  Fly    65 NWWWCGGSIIGHTWVLTAAHCTAGADEASLYYGAVNYNEPAFRHTVSSE-NFIR----YPHYV-- 122

  Fly   122 KFENDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAGLEGPSFDRRHSATQRLDK 186
            ..::|||:|: |..|.|..||..|.|||:.:.....|  |:.:..||. |..:|..:...   |.
  Fly   123 GLDHDLALIK-TPHVDFYSLVNKIELPSLDDRYNSYE--NNWVQAAGW-GAIYDGSNVVE---DL 180

  Fly   187 RIKMTYTKIDSK-----ECHEKQARF-----PEELICGHTERSPL-----SGSALTEASGTPRQF 236
            |:      :|.|     ||   ||.:     .|..||..|.....     ||..|....|.    
  Fly   181 RV------VDLKVISVAEC---QAYYGTDTASENTICVETPDGKATCQGDSGGPLVTKEGD---- 232

  Fly   237 HLLGIA--VAGFFSSDLDHQGYLNIRPHLDWISKNS 270
            .|:||.  |:.:........|:..:..:|:||.:.:
  Fly   233 KLIGITSFVSAYGCQVGGPAGFTRVTKYLEWIKEET 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 42/131 (32%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 69/254 (27%)
Tryp_SPc 41..266 CDD:238113 71/255 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.