DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG11841

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:265 Identity:63/265 - (23%)
Similarity:103/265 - (38%) Gaps:54/265 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DNIIAEPTEHPWVVRIVGVTKDGSNTLLCTGILIDSRRVVTAAHCVSKDESESIYGVVFG----D 100
            |...|||.|.|:..|:.....:......|.|.||.:|.|:|||||...:..| :..|..|    |
  Fly    74 DGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGE-VNVVRLGELEFD 137

  Fly   101 SDSSNINL----VSAVTVHPDYSPRKFENDLAIIELTKEVVFSDLVQPICLP------SVSEMVP 155
            :|:.:...    |.|:..||.:...:..||:.|::|.:||.|:....|.|||      ..|.:..
  Fly   138 TDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLPFDDGEQHESFIAI 202

  Fly   156 G------SETSNSKLIVAGLEG------PSFDRRHSATQRLDKRIKMTYTKIDSKE-CHEKQA-- 205
            |      ::..:.||:...|:|      .|.|.........:.:.::.....|:|: |:....  
  Fly   203 GWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDANDELPNGYEPKSQLCIGSRDNKDTCNGDSGGP 267

  Fly   206 --RFPEELICGHTERSPLSGSALTEASGTPRQFHLLGIAVAGFFSSDLD-HQGYLNIRPHLDWIS 267
              .:.::|.|                     .:|::||..||...|..| ...|..:...|:||.
  Fly   268 VLAYHKDLAC---------------------MYHVMGITSAGITCSTPDIPSAYTRVHYFLNWIK 311

  Fly   268 KNSSK 272
            ...:|
  Fly   312 GELAK 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 41/143 (29%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 61/258 (24%)
Tryp_SPc 72..310 CDD:214473 60/257 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.