DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG10232

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:270 Identity:67/270 - (24%)
Similarity:111/270 - (41%) Gaps:70/270 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 AEPTEHPWVVRIVGVTKDGSN-TLLCTGILIDSRRVVTAAHCVSKDESES----IYGVVFGDSDS 103
            |.|.|:||:..::...:..|. |..|:|.||:.|.|:||||||.||:..:    :..|..|:.| 
  Fly   263 ARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVKDKMVNTDLVLRRVRLGEHD- 326

  Fly   104 SNINLVSAVTVHPD-------------------------YSPRKFENDLAIIELTKEVVFSDLVQ 143
                    :|.:||                         ::..:||:|:|::.|...|.::..:.
  Fly   327 --------ITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFESDIALVRLQTPVRYTHEIL 383

  Fly   144 PICLPSVSEMVPGSETSNSKLIVAGLEGPSFDRRHSATQRLDKRIKMTYTKIDSK-ECHEKQARF 207
            |||:|  .:.:|   ..|..|.:||. |.:.:|.:|       ::.:..|..::: .|.:|.:.|
  Fly   384 PICVP--KDPIP---LHNHPLQIAGW-GYTKNREYS-------QVLLHNTVYENRYYCQDKISFF 435

  Fly   208 -PEELICGHTERSPLSGSALTEA-SGTPRQFHLLG-----IAVAGFFSSDLDHQG------YLNI 259
             .|..||.    |.:.|....|. ||.|....|..     :.:||..|...::.|      |...
  Fly   436 RNESQICA----SGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGSENCGDRKPGVYTKT 496

  Fly   260 RPHLDWISKN 269
            .....||..|
  Fly   497 GAFFSWIKAN 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 40/153 (26%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 66/268 (25%)
Tryp_SPc 260..503 CDD:214473 64/265 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.