DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and SPE

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:290 Identity:69/290 - (23%)
Similarity:122/290 - (42%) Gaps:70/290 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CG-IFNEKQYNSDNIIAEPTEHPWVVRIVGVTKDGSNTLL--CTGILIDSRRVVTAAHCVSKDES 90
            || :|.::.:...|...  .|.||:| ::...|..|.|..  |.|.|::||.|:||.||::..|.
  Fly   127 CGFLFADRIFGGTNTTL--WEFPWMV-LLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLASREL 188

  Fly    91 ES----IYGVVFGDSDS------------------SNINL-VSAVTVHPDYSPRKFE--NDLAII 130
            :.    ::.|..|:.|:                  .:|:: |....:|..|:|...:  ||:|::
  Fly   189 DKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQRNDIALV 253

  Fly   131 ELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAGLE----GPSFDRRHSATQRLDKRIKMT 191
            .|.:.|.::|.|:|||||:     .|...:|  .:..|::    |.:.:.:.||.     ::|:|
  Fly   254 RLKRIVSYTDYVRPICLPT-----DGLVQNN--FVDYGMDVAGWGLTENMQPSAI-----KLKIT 306

  Fly   192 YTKIDSKECHEKQARFPEEL--------------ICGHTERSPLSGSALTEASGTPRQFHLLGIA 242
            ....:...|.||.:.|..:|              .||.....||   .:..::|....|::.|:.
  Fly   307 VNVWNLTSCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPL---MVPISTGGRDVFYIAGVT 368

  Fly   243 VAGFFSSDLDHQG----YLNIRPHLDWISK 268
            ..|.....|  :|    |......:|||.:
  Fly   369 SYGTKPCGL--KGWPGVYTRTGAFIDWIKQ 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 40/150 (27%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 66/282 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.