DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG31199

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:307 Identity:83/307 - (27%)
Similarity:139/307 - (45%) Gaps:59/307 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KLLTFLLTITTLHPTIQAASVG-QECGIFNEKQ-YNSDNIIAEPTEHPWVVRIV------GVTKD 61
            ::...||.:....|.:::|.|. .:||.|:|.| .|..:..|.||||.||.|||      |..:|
  Fly     4 RIAVLLLLVGLFGPEVRSAKVNDDQCGAFDEDQMLNMQSTFAIPTEHQWVARIVYGKGFEGKIRD 68

  Fly    62 GSNTLLCTGILIDSRRVVTAAHCVSK----DESESIY----------GVVFGDSD------SSNI 106
            ..    |.|:|:..|.|:..|||..:    .|:.|::          ||...::|      |..|
  Fly    69 NG----CLGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLGVHNKSAPVGVRVCETDGYCVRPSQEI 129

  Fly   107 NLVSAVTVHPDYSPRKFENDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSK-LIVAGLE 170
            .| :.:.:||||..|..:|.||::.|.::......|.|||:|..|.:   :||..:: .:||||.
  Fly   130 KL-AEIAIHPDYDSRTLKNSLAVLTLQRDAKIYPNVMPICMPPPSLL---NETLVAQTFVVAGLR 190

  Fly   171 GPSFDRRHSATQRLDKRIKMTYTKIDSKECHEKQARF--PEELICGHTER-------SPLSGSAL 226
              .|:         |.|:|.....:....|..|....  ....:||:.::       :||.|  |
  Fly   191 --VFE---------DFRLKTWVNTLSRGFCQSKVKTLVTSSNTVCGYHKQPVAYYLGAPLVG--L 242

  Fly   227 TEASGTPRQFHLLGIAVAGFFSSDLDHQGYLNIRPHLDWISKNSSKL 273
            .:.....:.::|:||.:...:.::.....:|.||.::|:|.:||:.|
  Fly   243 QKKGHVTQNYYLVGIMIDWRWENNRIMSSFLAIRNYMDFIRQNSNSL 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 46/150 (31%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 62/232 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016580
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.