DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG5255

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:227 Identity:58/227 - (25%)
Similarity:98/227 - (43%) Gaps:39/227 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLTFLLTITTLHPTIQAASVGQECGIFNEKQYNSDNII----AEPTEHPWVVRIVGVTKDGSNTL 66
            :|..||.:...  |..|||     .|....||..:.|:    |.....|:.:.:.|:   ||...
  Fly     1 MLLILLPLVLF--TSSAAS-----QILYPPQYTKNRIVGGEEAAAGLAPYQISLQGI---GSGAH 55

  Fly    67 LCTGILIDSRRVVTAAHCVSKDESESIYGVVFGDSD----SSNINLVSAVTVHPDYSPRKFENDL 127
            .|.|.:||.|.::||||| ::....:.:.|:.|..|    .|.......:..|.:|:|||:.||:
  Fly    56 SCGGAIIDERWIITAAHC-TRGRQATAFRVLTGTQDLHQNGSKYYYPDRIVEHSNYAPRKYRNDI 119

  Fly   128 AIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAG-----LEGPSFDRRHSATQRLDKR 187
            |::.|.:.:||.:..||:.|.. ..:|||     |:|::.|     |.|....|..|        
  Fly   120 ALLHLNESIVFDNATQPVELDH-EALVPG-----SRLLLTGWGTLSLGGDVPARLQS-------- 170

  Fly   188 IKMTYTKIDS-KECHEKQARFPEELICGHTER 218
            :::.|...:. :..|:...|.....:|...::
  Fly   171 LEVNYVPFEQCRAAHDNSTRVDIGHVCTFNDK 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 38/127 (30%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 48/192 (25%)
Tryp_SPc 30..252 CDD:238113 48/191 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.