DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG5246

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:241 Identity:60/241 - (24%)
Similarity:99/241 - (41%) Gaps:53/241 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PWVVRIVGVTKDGSNTL---LCTGILIDSRRVVTAAHCVSKDESESIYGVVFGDSDSSNIN---L 108
            |:.|.|:       ||.   :|.|.:|..:.::|||||:  :.......:|.|..|.:...   |
  Fly    54 PYQVSIM-------NTFGEHVCGGSIIAPQWILTAAHCM--EWPIQYLKIVTGTVDYTRPGAEYL 109

  Fly   109 VSAVTVHPDYSPRKFENDLAIIELTKEVVFSDLVQPI------CLPSVSEMVPGSETSNSKLIVA 167
            |....:|..:....:.||:|:|...|.:|:.||.|||      .||.|.:          ||.:.
  Fly   110 VDGSKIHCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGD----------KLTLT 164

  Fly   168 GLEGPSFDRRHSATQRLDKRIKMTYTKIDSKECHEKQARF-PEELICGHTERSP-----LSGSAL 226
            |........|:| ||.  ::|.:.|...|:.:...:.|.: .|..:|..|:...     .||..|
  Fly   165 GWGSTKTWGRYS-TQL--QKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQEGEGSCHGDSGGPL 226

  Fly   227 TEASGTPRQFHLLGIAVAGFFSSDLDHQGYL----NIRPHLDWISK 268
            .:|:.|     |:|:...|    :....||.    ::..:.|||.:
  Fly   227 VDANQT-----LVGVVNWG----EACAIGYPDVFGSVAYYHDWIEQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 35/129 (27%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 58/237 (24%)
Tryp_SPc 42..263 CDD:238113 60/239 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.