DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG31265

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster


Alignment Length:237 Identity:56/237 - (23%)
Similarity:97/237 - (40%) Gaps:41/237 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PWVVRIVGVTKDGSNTLLCTGILIDSRRVVTAAHCVSKDESESIYGVVFGD---SDSSNINLVSA 111
            |:.|.:..:.  ||:.  |.|.:::...::||.||| ::...::..|:.|.   ::...|...:.
  Fly    49 PYQVSLQPIV--GSHN--CGGAILNENWIITAGHCV-ENFIPALVNVITGTNKWAEPGAIYYTAE 108

  Fly   112 VTVHPDYSPRKFENDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAG-----LEG 171
            :..|..|......||:|:::||:.:.|::|.|||.||:....: |.|     :::.|     ..|
  Fly   109 IHKHCMYDQPYMHNDIALVKLTENITFNELTQPIALPTRPVQL-GEE-----IVLTGWGSDVAYG 167

  Fly   172 PSFDRRHSATQRLDKRIKMTYTKIDSKECHEKQARFPEELICGHTERSPLSGSALTEA-SGTP-- 233
            .|.:..|          |:|...:...||:|...| ...:..||.......|...... ||.|  
  Fly   168 SSMEDLH----------KLTVGLVPLDECYETFNR-TSSMGVGHICTFSREGEGACHGDSGGPLV 221

  Fly   234 RQFHLLGIA----VAGFFSSDLDHQGYLNIRPHLDWISKNSS 271
            ....|:|:.    ..|....|:.    .|:..:||||....|
  Fly   222 SNGQLVGVVNWGRPCGVGLPDVQ----ANVYYYLDWIRSKLS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 30/120 (25%)
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 53/230 (23%)
Tryp_SPc 39..257 CDD:238113 55/233 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.