DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG3505

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:292 Identity:75/292 - (25%)
Similarity:116/292 - (39%) Gaps:72/292 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 HPTIQAASVGQECG-IFNEKQYNSDNIIAEPTEHPWVVRIVGVTKDGSNTLLCTGILIDSRRVVT 80
            ||.:.:     :|| :..::..::|..|   .|.||:..|.....:......|.|:||..|.|:|
  Fly    93 HPLLPS-----DCGKVRWQRSNDTDTRI---REFPWLALIEYTRGNQEKIHACGGVLISDRYVLT 149

  Fly    81 AAHCVSKDESES--IYGVVFGDSDSSNIN---------------------LVSAVTVHPDY--SP 120
            |||||::..:.:  |..|..|:.|:|. |                     .:..:..||.|  :.
  Fly   150 AAHCVAQAATSNLQITAVRLGEWDTST-NPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTD 213

  Fly   121 RKFENDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAGLEGPSFDRRHSATQRLD 185
            |...||:|::.|......:|.|||||||  ::.:...|..:....|||.:.       |::||:.
  Fly   214 RTQINDIALVRLASPAKLNDFVQPICLP--NKQLRADELEDLVTEVAGWQA-------SSSQRMR 269

  Fly   186 KRIKMTYTKIDS-KECHEK----QARFPEELICGHTERSPLSGSALTEASGTPRQFHLLGIAVAG 245
            |    .|..|.| :||..|    |.|.....:||.|......|:    |.|....|...|..:.|
  Fly   270 K----GYVTISSIEECQRKYASQQLRIQASKLCGLTNSQECYGN----AGGPLMLFKNDGYLLGG 326

  Fly   246 FFS-----------SDLDHQGYLNIRPHLDWI 266
            ..|           .|:    |..:..::|||
  Fly   327 LVSFGPVPCPNPDWPDV----YTRVASYIDWI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 40/148 (27%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 71/269 (26%)
Tryp_SPc 111..354 CDD:214473 69/267 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.