DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG31326

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:303 Identity:65/303 - (21%)
Similarity:105/303 - (34%) Gaps:90/303 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LHPTIQAASVGQECG---------IFNEKQYNSDNIIAEPTEHPWVVRIVGVTKDGSNTLLCTGI 71
            |.|....:|.|..||         ||..|......:       ||:|.|....:......:|.|.
  Fly   250 LVPQQNPSSNGIPCGRERASTTPLIFQGKSLQRGQL-------PWLVAIFERRESNGPAFICGGT 307

  Fly    72 LIDSRRVVTAAHCV---SKDESESIYGVVFGDS-----DSSNINLVSAVTVHPDYSPRKF-ENDL 127
            ||.:..|::||||.   .:|...|...|..|.:     .......||.:.:|.::..::| |.||
  Fly   308 LISTSTVLSAAHCFRAPGRDLPASRLAVSLGRNTLAIHSDGEFRGVSQLIIHENFQFKQFTEADL 372

  Fly   128 AIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAGLE------GPSFDRRHSATQRLDK 186
            |::.|.:.|.::|.:.||||.|         |||...:..||:      ||  |...:....:.|
  Fly   373 ALVRLDEPVRYTDYIVPICLWS---------TSNRMDLPQGLKSYVAGWGP--DETGTGNTEVSK 426

  Fly   187 ------------RIKMTYTKID-SKECHEKQARFPEELICGHTERSPL--------------SGS 224
                        .:::.:..:. |..|.:|....|    |......||              ||.
  Fly   427 VTDLNIVSEANCALELPHVLVQPSSLCAKKTGAGP----CASDGGGPLMLREQDVWVLRGVISGG 487

  Fly   225 ALTEASGTPRQFHLLGIAVAGFFSSDLDHQG-YLNIRPHLDWI 266
            .:.|...|                .:|.... :.::..|::|:
  Fly   488 VINEKENT----------------CELSKPSVFTDVAKHIEWV 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 36/132 (27%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 57/276 (21%)
Tryp_SPc 277..514 CDD:214473 56/274 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.