DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and Prss45

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001008864.1 Gene:Prss45 / 408244 RGDID:1303021 Length:330 Species:Rattus norvegicus


Alignment Length:281 Identity:72/281 - (25%)
Similarity:115/281 - (40%) Gaps:70/281 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 YNSDNIIAEPT-------------EH-PWVVRIVGVTKDGSNTLLCTGILIDSRRVVTAAHCVSK 87
            ||.|:  |||.             .| ||.|.:     ...|..:|.|.|||...||:||||:..
  Rat    37 YNEDH--AEPVCGAPWWSDSLEERHHWPWEVSL-----QIENEHVCGGALIDQSWVVSAAHCIQG 94

  Fly    88 DESESIYGVVFGDS----DSSNINL---VSAVTVHPDYSPRKF-ENDLAIIELTKEVVFSDLVQP 144
            ::.   |.|:.|.|    ..|...|   |..:.:||.|..:.| .:|:|::.|...|.|:..:||
  Rat    95 NKE---YLVMLGSSTLQPSGSPWALKIPVGDIIMHPKYWGQNFIRSDIALLCLETPVTFNKYIQP 156

  Fly   145 ICLPSVSEMVPGSETSNSKL-IVAGLEGPSFDRRHSATQRLDKRIKMTYTK---IDSKEC---HE 202
            ||||        ....|.|: :...:.|....::|.:. :|.:.:::...:   :|:|.|   ..
  Rat   157 ICLP--------EHNFNLKVGMKCWVTGWGQAKQHPSA-KLTRSLELWEAEVSIVDNKNCDRVFH 212

  Fly   203 KQARFPE-------ELIC--GHTERSPLSGSALTEASGTPRQFHLLG-IAVAGFFSSDL------ 251
            |:..:|:       .:||  .|.| :|..|.     .|.|....:.| ..:||.||.:.      
  Rat   213 KKTFYPQVIPLIRKNMICTTNHRE-NPCYGD-----PGGPLACEVHGRWILAGIFSWEKACTKAP 271

  Fly   252 DHQGYLNIRPHLDWISKNSSK 272
            :...|..|..:..||.:..|:
  Rat   272 NLSVYTRIDKYTGWIKEQVSR 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 43/146 (29%)
Prss45NP_001008864.1 Tryp_SPc 57..289 CDD:238113 65/254 (26%)
Tryp_SPc 57..286 CDD:214473 63/251 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336779
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.