DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG14088

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:257 Identity:62/257 - (24%)
Similarity:103/257 - (40%) Gaps:61/257 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLTFLLTITTLHPTIQAASVGQECGIFNEKQYNSDNIIAEPTEHPWVV------RIVGVTKDGSN 64
            :||.||..  |..|..|..:|..||  ..:...|.:|:.     ||..      |||||      
  Fly    10 VLTSLLIF--LSGTGSAQFLGNICG--ERRDGLSPDIVG-----PWTAILHHFGRIVGV------ 59

  Fly    65 TLLCTGILIDSRRVVTAAHCVSKDESESIYGVV------FG--DSDSSNINLVSAVTVHPDYSPR 121
                 |.||..|.::|..||     .:|| ||:      :|  .|:.:..::|:|...:.:::|.
  Fly    60 -----GTLIHERFILTDVHC-----GDSI-GVIRARLGEYGRIGSELAEDHIVAAFFSNANFNPE 113

  Fly   122 KFENDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKL-IVAGLEGPSFDRRHSATQRLD 185
            ...|::.:::|.:.||:.:.:.|:|:...|.|    :|...:| ...|....:.|:......:..
  Fly   114 TQANNMGLMKLLRTVVYKEHIIPVCILMDSRM----QTFADELDYFNGTTWKNSDKSPMLRSKTV 174

  Fly   186 KRIKMTYTKIDSKECHEKQARFPEELICGHTERSPL---SGSALTEASG--TPRQFHLLGIA 242
            .|:.....|:|.           .:...||.:....   ||:|||....  .|.:..|.|||
  Fly   175 IRMPQACGKLDH-----------GQFCAGHKDLDSCDEPSGAALTREIDYIGPNRTVLFGIA 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 33/138 (24%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 51/221 (23%)
Tryp_SPc 42..248 CDD:214473 51/221 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.