DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG7542

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:236 Identity:56/236 - (23%)
Similarity:90/236 - (38%) Gaps:55/236 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 GSNTLLCTGILIDSRRVVTAAHCVSKDESESIY--GVVFGDSDSSNINLV----SAVTVHPDYSP 120
            |:.:..|.|.||....::|||||:...||.::|  .:..||........:    |.:.||.:|..
  Fly    49 GNWSTWCGGTLISHYWIITAAHCMDGAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMA 113

  Fly   121 RKFENDLAIIELTKEVVFSDLVQPICLP-----------SVSEMVPG----SETSNS-KLIVAGL 169
            ....||:::|.|...|.|:|.::...||           |:.....|    |:.|:| ..::..:
  Fly   114 STVVNDISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYV 178

  Fly   170 EGP----SFDRRHSATQRLDKRIKMTYTKIDSKECHEKQARFPEELICGHTERSPLSGSALTEAS 230
            |.|    |..|.:.:....:|.|.|:.|. ....||..                  ||..|....
  Fly   179 EMPIMPHSLCRMYWSGAVSEKMICMSTTS-GKSTCHGD------------------SGGPLVYKQ 224

  Fly   231 GTPRQFHLLGIAVAGFFSSDLDHQ-----GYLNIRPHLDWI 266
            |  ...:|:|   :..|.:.:..|     .:..|..:||||
  Fly   225 G--NSSYLIG---STSFGTSMGCQVGFPAVFTRISSYLDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 33/127 (26%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 56/236 (24%)
Tryp_SPc 27..260 CDD:214473 54/234 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.