DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and Jon74E

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:301 Identity:74/301 - (24%)
Similarity:116/301 - (38%) Gaps:76/301 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLTFLLTITTLHPTIQAASV--------------GQECGIFNEKQYNSDNIIAEPTE-HPWVVRI 55
            :|.|||.:      :|..|:              |.|....|:..|.....|.||.: :.|    
  Fly     6 ILVFLLIL------VQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCW---- 60

  Fly    56 VGVTKDGSNTLLCTGILIDSRRVVTAAHCVSKDESESIY-GVVFGDSDSSNINLVS-AVTVHPDY 118
                        |...||..|.::||||||.|..:.:.| |.|...:....|...: .|.:|||:
  Fly    61 ------------CGASLISDRYLLTAAHCVEKAVAITYYLGGVLRLAPRQLIRSTNPEVHLHPDW 113

  Fly   119 SPRKFENDLAIIELTKEVVFSDLVQPICLPSVS------EMVPGSETSNSKLIVAGLEGPSFDRR 177
            :.:..|||:|::.|.::.:..|.::||.||.:|      :.||.        |.:|     :.|.
  Fly   114 NCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPA--------IASG-----WGRM 165

  Fly   178 HSATQRLDKRIKMTYTKIDSKE-CHEKQARFPEELICGHTERSPLSGSALTEASGTPRQFH---- 237
            :..:..:...::..|..::|.| |....|......||..|....   |..|..||.|..:.    
  Fly   166 NDESTAISDNLRYVYRFVESNEDCEYSYANIKPTNICMDTTGGK---STCTGDSGGPLVYSDPVQ 227

  Fly   238 ----LLGIAVAGFFSSDLDHQGY----LNIRPHLDWISKNS 270
                |:|:...|..|...  :||    ..|..:||||.:.|
  Fly   228 NADILIGVTSYGKKSGCT--KGYPSVFTRITAYLDWIGEVS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 36/132 (27%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 65/264 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.